DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10631 and zag-1

DIOPT Version :9

Sequence 1:	NP_609998.1	Gene:	CG10631 / 35262	FlyBaseID:	FBgn0032817	Length:	3781	Species:	Drosophila melanogaster
Sequence 2:	NP_500424.3	Gene:	zag-1 / 177144	WormBaseID:	WBGene00006970	Length:	596	Species:	Caenorhabditis elegans

Alignment Length:	193	Identity:	47/193 - (24%)
Similarity:	73/193 - (37%)	Gaps:	50/193 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   192 KSEPMEAYQQPPN-------PMAPPPAPEVL------IKSEPIDEHSYKSNYIDDNTPFADFSKF 243
            :.:|::|.:.|.:       |......|.:|      :..:.:|:.  ||:..|.::..::.||.
Worm   404 EEKPIKAEESPVSSGSSSIWPSFIGQYPSILDSASLSVLEKALDQQ--KSSEDDASSLCSNESKL 466

  Fly   244 SEFSEDMLSPKVELTVKDESYGRTTSSFLRRKQQSDRGNESLPICQRCKEVFFKKQVYLRHVAES 308
            .:|      |...|  |:|                    |.|..|.:|.:||.|:....||..|
Worm   467 LKF------PTTPL--KEE--------------------EGLFSCDQCDKVFGKQSSLARHKYE- 502

  Fly   309 NCGIQEYDFKCSTCPMSFMTTEELQRHKLHHRADR-FFCHKYCGKHFDTIAECEAHEYMQHEY 370
            :.|.:.|  ||..|..:|.....|..||..|..:: |.|.| |.|.|........|  |.|.|
Worm   503 HSGQRPY--KCDICEKAFKHKHHLTEHKRLHSGEKPFQCDK-CLKRFSHSGSYSQH--MNHRY 560

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10631	NP_609998.1	C2H2 Zn finger	288..311	CDD:275368	8/22 (36%)
		C2H2 Zn finger	319..339	CDD:275368	6/19 (32%)
		DM3	584..642	CDD:128933
		DM3	683..738	CDD:128933
		DM3	775..832	CDD:128933
		DM3	945..1000	CDD:128933
		DM3	1038..1096	CDD:128933
		DM3	1145..1198	CDD:128933
		THAP	1236..1308	CDD:214951
		DM3	1349..1406	CDD:128933
		THAP	1424..1493	CDD:214951
		DM3	1538..1596	CDD:128933
		DM3	1683..1739	CDD:128933
		DM3	1778..1831	CDD:128933
		DM3	1980..2033	CDD:128933
		DM3	2147..2202	CDD:128933
		DM3	2308..2365	CDD:128933
		DM3	2434..2491	CDD:128933
		DM3	2539..2598	CDD:128933
		DM3	2622..2680	CDD:128933
		DM3	2718..2775	CDD:128933
		DM3	2907..2965	CDD:128933
		DM3	3098..3155	CDD:128933
		DM3	3227..3284	CDD:128933
		DM3	3396..3452	CDD:128933
		DM3	3544..3601	CDD:128933
		THAP	3621..>3669	CDD:283206
		DM3	3690..3748	CDD:128933
zag-1	NP_500424.3	zf-C2H2	24..46	CDD:278523
		C2H2 Zn finger	26..46	CDD:275368
		zf-H2C2_2	38..61	CDD:290200
		homeodomain	225..282	CDD:238039
		C2H2 Zn finger	483..503	CDD:275368	8/20 (40%)
		zf-H2C2_2	495..520	CDD:290200	9/27 (33%)
		COG5048	506..>559	CDD:227381	17/57 (30%)
		C2H2 Zn finger	511..531	CDD:275368	6/19 (32%)
		zf-H2C2_2	523..548	CDD:290200	10/25 (40%)
		C2H2 Zn finger	539..556	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S3134
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.950