DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10631 and ZNF366

DIOPT Version :9

Sequence 1:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster
Sequence 2:NP_689838.1 Gene:ZNF366 / 167465 HGNCID:18316 Length:744 Species:Homo sapiens


Alignment Length:715 Identity:138/715 - (19%)
Similarity:230/715 - (32%) Gaps:249/715 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 GSYPYIKSEPME---AYQQP-PNPMAPPPAPEVLIKSEPIDEHSYKSNYIDDNTPFADFSKFS-- 244
            |..| :|.||::   .:.|| |.|..|.|.| ...|..|.....:   ::..::|| .||:.:  
Human   146 GGKP-VKQEPIKPSAVWPQPTPTPFLPTPYP-YYPKVHPGLMFPF---FVPSSSPF-PFSRHTFL 204

  Fly   245 --EFSEDMLSPKVELTVKDESYGRTTSSFLRRKQQSDRGNESLPI----------------CQRC 291
              :..|.:|..|.|....:|:           ||:.:|.:.::.|                |..|
Human   205 PKQPPEPLLPRKAEPQESEET-----------KQKVERVDVNVQIDDSYYVDVGGSQKRWQCPTC 258

  Fly   292 KEVFFKKQVYLRHV---------AESNCG--------IQEY--------DFKCSTCPMSFMTTEE 331
            ::.:..|...:.|:         |.::||        :..:        ..||..|..:|..|..
Human   259 EKSYTSKYNLVTHILGHSGIKPHACTHCGKLFKQLSHLHTHMLTHQGTRPHKCQVCHKAFTQTSH 323

  Fly   332 LQRHKLHHRADRFFCHKYCGKHFDTIAECEAHEYMQHEYDSFVCNMCSGTFATREQLYAHLPQHK 396
            |:||.:.|...:....:.||:.|...:|.:|||.........:|..|...|.|..||..||..|:
Human   324 LKRHMMQHSEVKPHNCRVCGRGFAYPSELKAHEAKHASGRENICVECGLDFPTLAQLKRHLTTHR 388

  Fly   397 FQQRFDCPICRLWYQTALELHEHRL----AAPYFCGKYYTGGQSSSASQSQAQQHQTNYKLQDCH 457
            ...:::|..|...:|...:|..|.:    ..||.|                          .:|.
Human   389 GPIQYNCSECDKTFQYPSQLQNHMMKHKDIRPYIC--------------------------SECG 427

  Fly   458 MATMEMPTTPHHKTTPSGSSLPATAALNSLLQQRQANADGAAMFAASAMKNEVNVKME-RSYSNS 521
            |..::    |||        |...:..:..:::.:....|......:.||..|.:... |:|...
Human   428 MEFVQ----PHH--------LKQHSLTHKGVKEHKCGICGREFTLLANMKRHVLIHTNIRAYQCH 480

  Fly   522 TSESSYSVQDSGYNNAYGSDSSMHAGAIAGPQAHSSTLDDSEDALCCVPLCGVRKSTSPTLQFFT 586
            ....|: ||....                  :||.....|.:...|  .|||             
Human   481 LCYKSF-VQKQTL------------------KAHMIVHSDVKPFKC--KLCG------------- 511

  Fly   587 FPKDEKYLNQWLHNLKMFHIPAASYANFRICSMHF-----PKRCIN-----------------RY 629
                 |..|: :||| |.|             ||.     |.:|:.                 ::
Human   512 -----KEFNR-MHNL-MGH-------------MHLHSDSKPFKCLYCPSKFTLKGNLTRHMKVKH 556

  Fly   630 SLCYWAVPTFNLGHDDV-----ANLYQNRELTNTFTTGEVARCSMP------------HCTSQRG 677
            .:....:.:..||...:     |.:.::.|....|...:..|..:|            ||..:..
Human   557 GVMERGLHSQGLGRGRIALAQTAGVLRSLEQEEPFDLSQKRRAKVPVFQSDGESAQGSHCHEEEE 621

  Fly   678 ESN---LKFYN-----------FPKDIKSLIKWCQNARLPVQAKEPRHFCSR-HFEERCIGKFRL 727
            |.|   ::.|:           .|:|:.:..:..... |....||.:...|: .:|:|..|    
Human   622 EDNCYEVEPYSPGLAPQSQQLCTPEDLSTKSEHAPEV-LEEACKEEKEDASKGEWEKRSKG---- 681

  Fly   728 KPWAVPTLHLGAQYGKIHDNPKNLYVEEKRC-----CLN---FCRRSRSSDFNMSLYRFPRDEVL 784
                    .|||:.|           :|:.|     ||:   |....|...|:..||...|||.|
Human   682 --------DLGAEGG-----------QERDCAGRDECLSLRAFQSTRRGPSFSDYLYFKHRDESL 727

  Fly   785  784
            Human   728  727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368 5/31 (16%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
DM3 584..642 CDD:128933 11/79 (14%)
DM3 683..738 CDD:128933 10/66 (15%)
DM3 775..832 CDD:128933 6/10 (60%)
DM3 945..1000 CDD:128933
DM3 1038..1096 CDD:128933
DM3 1145..1198 CDD:128933
THAP 1236..1308 CDD:214951
DM3 1349..1406 CDD:128933
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933
DM3 3227..3284 CDD:128933
DM3 3396..3452 CDD:128933
DM3 3544..3601 CDD:128933
THAP 3621..>3669 CDD:283206
DM3 3690..3748 CDD:128933
ZNF366NP_689838.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..228 6/32 (19%)
COG5048 253..>549 CDD:227381 73/387 (19%)
C2H2 Zn finger 255..275 CDD:275368 4/19 (21%)
C2H2 Zn finger 283..303 CDD:275368 2/19 (11%)
C2H2 Zn finger 311..331 CDD:275368 7/19 (37%)
C2H2 Zn finger 339..359 CDD:275368 7/19 (37%)
C2H2 Zn finger 367..387 CDD:275368 8/19 (42%)
C2H2 Zn finger 395..415 CDD:275368 5/19 (26%)
C2H2 Zn finger 423..443 CDD:275368 7/57 (12%)
C2H2 Zn finger 451..471 CDD:275368 4/19 (21%)
Interaction with NRIP1. /evidence=ECO:0000269|PubMed:17085477 455..744 65/351 (19%)
C2H2 Zn finger 479..499 CDD:275368 5/38 (13%)
C2H2 Zn finger 507..527 CDD:275368 13/54 (24%)
C2H2 Zn finger 535..554 CDD:275368 1/18 (6%)
PXDLS. /evidence=ECO:0000269|PubMed:16393996, ECO:0000269|PubMed:17085477 590..594 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 603..627 4/23 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 664..692 11/50 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.