DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10631 and LOC1280086

DIOPT Version :10

Sequence 1:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster
Sequence 2:XP_319888.4 Gene:LOC1280086 / 1280086 VectorBaseID:AGAMI1_002537 Length:422 Species:Anopheles gambiae


Alignment Length:375 Identity:74/375 - (19%)
Similarity:123/375 - (32%) Gaps:125/375 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 HISQQ--------RPYM-GHNIMTGSYPYIKSEPMEAYQQPPNPMAPPPAPEVLIKSEPIDEHSY 226
            |:.||        |.|| |.:.|:.||                          .:..|.:.:.|:
Mosquito    66 HLKQQCENSDMRLRQYMNGGSAMSYSY--------------------------TLDKETMTDDSW 104

  Fly   227 KSNYIDDNTPFADFSKFSEFSEDMLSPKVELTVKDESYGRTTSSFLRRK-----QQSDRGNESLP 286
            ..:.:|..            .:|..||:           :.|:|..|.:     ::..||.:.:|
Mosquito   105 LLSGMDHK------------GDDQKSPE-----------KKTNSKKRYRVKLPEERKKRGPKPMP 146

  Fly   287 ----ICQRCKEVF---FKKQVYLRHVAESNCGIQEYDFKCSTCPMSFMTTEELQRHKLHHRADRF 344
                .|.:|.:.|   .:.|::||    ::.|  |..:.|:.||..|.....|..|...|..:|.
Mosquito   147 KIPQTCYQCHKSFKCAAQLQMHLR----THSG--EKPYACNLCPRRFAQKHNLAIHLRTHTGERP 205

  Fly   345 FCHKYCGKHFDTIAECEAHEYMQHEYDSFVCNMCSGTFATREQLYAHLPQHKFQQRFDCPICRLW 409
            :..:.|.|.|..:...:||:.:.......||..|:..|.|...|..|:..|...:.:.|.||...
Mosquito   206 YQCEICSKQFSALGNFQAHKKIHTNERDHVCPSCNKGFITSGDLTRHMISHSGIKNYHCDICAKS 270

  Fly   410 YQTALELHEHRLAAP-----------YFCGKYYT----------------------------GGQ 435
            :....::..|:....           :.|.|.:.                            .||
Mosquito   271 FSRNRDMMAHKRKMHLEECGNECYKCHECHKVFATLNNLNVHMRVHAQEENVADPVGELMPPHGQ 335

  Fly   436 SSSASQSQAQQHQTNYKLQDCH------MATMEMP---TTPHHKTTPSGS 476
            ... .|.|.||||.:::.|..|      .|..::|   ..|.|...|.||
Mosquito   336 QQQ-QQQQQQQHQQHHQQQLQHQLHHQQQAHQQVPVPLALPPHALGPPGS 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368 6/25 (24%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
DM3 584..642 CDD:128933
DM3 683..738 CDD:128933
DM3 775..832 CDD:128933
DM3 945..1000 CDD:128933
DM3 1038..1096 CDD:128933
DM3 1145..1198 CDD:128933
THAP 1236..1308 CDD:214951
DM3 1349..1406 CDD:128933
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933
DM3 3227..3284 CDD:128933
DM3 3396..3452 CDD:128933
DM3 3544..3601 CDD:128933
THAP 3622..>3673 CDD:461662
DM3 3690..3748 CDD:128933
LOC1280086XP_319888.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.