DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and NF-YB4

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_172377.1 Gene:NF-YB4 / 837424 AraportID:AT1G09030 Length:139 Species:Arabidopsis thaliana


Alignment Length:121 Identity:51/121 - (42%)
Similarity:76/121 - (62%) Gaps:11/121 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGD 100
            :.::||.|||.|:.::||..:|.|.||:|:|::.:|||.:|||||::.||.|:...|||||||||
plant     1 MTDEDRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASEKCHRENRKTVNGD 65

  Fly   101 DLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRNLFLDASYPHNEDGSSANDAGKQ 156
            |:..|.|.||.|||.:.:..:|.||||:.:.           ..|....:||:|.:
plant    66 DIWWALSTLGLDNYADAVGRHLHKYREAERE-----------RTEHNKGSNDSGNE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 33/62 (53%)
NF-YB4NP_172377.1 CBFD_NFYB_HMF 6..71 CDD:395650 34/64 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2683
eggNOG 1 0.900 - - E2759_KOG0869
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1529111at2759
OrthoFinder 1 1.000 - - FOG0001364
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X859
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.