DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and NF-YB6

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001318754.1 Gene:NF-YB6 / 834818 AraportID:AT5G47670 Length:234 Species:Arabidopsis thaliana


Alignment Length:92 Identity:53/92 - (57%)
Similarity:73/92 - (79%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGD 100
            :||||||:||.|:|:||:..:|.:.||:.|::|.|||||||:||||:.||.||...|.|||:..:
plant    56 VREQDRFMPIANVIRIMRRILPAHAKISDDSKETIQECVSEYISFITGEANERCQREQRKTITAE 120

  Fly   101 DLLVAFSNLGFDNYVEPLSIYLQKYRE 127
            |:|.|.|.||||:|:|||::||.:|||
plant   121 DVLWAMSKLGFDDYIEPLTLYLHRYRE 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 33/62 (53%)
NF-YB6NP_001318754.1 CBFD_NFYB_HMF 61..126 CDD:395650 34/64 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2683
eggNOG 1 0.900 - - E2759_KOG0869
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I1840
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1529111at2759
OrthoFinder 1 1.000 - - FOG0001364
OrthoInspector 1 1.000 - - otm2648
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X859
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.