DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and NF-YB13

DIOPT Version :10

Sequence 1:NP_609997.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_851060.1 Gene:NF-YB13 / 832373 AraportID:AT5G23090 Length:159 Species:Arabidopsis thaliana


Alignment Length:115 Identity:34/115 - (29%)
Similarity:66/115 - (57%) Gaps:2/115 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGDDL 102
            ::|..||...:.||:|..:|.:.::|:||::.:.||..|||:.:|||:.:....|:::|:..:.:
plant    11 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLVSSESNDVCNKEDKRTIAPEHV 75

  Fly   103 LVAFSNLGFDNYVEPL-SIYLQ-KYRESNKSDRNLFLDASYPHNEDGSSA 150
            |.|...|||..|:|.: :.|.| ||.....:.|::..:......|:.::|
plant    76 LKALQVLGFGEYIEEVYAAYEQHKYETMQDTQRSVKWNPGAQMTEEEAAA 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_609997.1 HFD_NFYB 36..126 CDD:467032 30/89 (34%)
NF-YB13NP_851060.1 HFD_Dr1 11..140 CDD:467030 34/115 (30%)

Return to query results.
Submit another query.