DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and NF-YB10

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001327562.1 Gene:NF-YB10 / 824502 AraportID:AT3G53340 Length:176 Species:Arabidopsis thaliana


Alignment Length:107 Identity:63/107 - (58%)
Similarity:83/107 - (77%) Gaps:3/107 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EASGDDSDKQDGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEA 85
            |:.||.|.:   .:.:|||||||||.||.:|||..:|.||||||||:|.:||||||||||::|||
plant    15 ESGGDQSPR---SLNVREQDRFLPIANISRIMKRGLPLNGKIAKDAKETMQECVSEFISFVTSEA 76

  Fly    86 IERSVAENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRE 127
            .::...|.|||:||||||.|.:.|||::|::||.:||.:|||
plant    77 SDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKVYLMRYRE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 42/62 (68%)
NF-YB10NP_001327562.1 CBFD_NFYB_HMF 32..97 CDD:395650 43/64 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2683
eggNOG 1 0.900 - - E2759_KOG0869
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38149
Inparanoid 1 1.050 134 1.000 Inparanoid score I1840
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1529111at2759
OrthoFinder 1 1.000 - - FOG0001364
OrthoInspector 1 1.000 - - otm2648
orthoMCL 1 0.900 - - OOG6_101084
Panther 1 1.100 - - O PTHR11064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X859
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.