DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and NF-YB1

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001189705.1 Gene:NF-YB1 / 818472 AraportID:AT2G38880 Length:164 Species:Arabidopsis thaliana


Alignment Length:152 Identity:74/152 - (48%)
Similarity:96/152 - (63%) Gaps:18/152 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DEASGDDSDKQDGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSE 84
            |..|....|..:.|..:|||||:|||.||.:|||..:|.||||.|||::.:|||||||||||:||
plant     3 DTPSSPAGDGGESGGSVREQDRYLPIANISRIMKKALPPNGKIGKDAKDTVQECVSEFISFITSE 67

  Fly    85 AIERSVAENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRNLFL--DASYPH---- 143
            |.::...|.||||||||||.|.:.|||::|:|||.|||.:|||..:::..||:  |....|    
plant    68 ASDKCQKEKRKTVNGDDLLWAMATLGFEDYLEPLKIYLARYREVFETNSVLFIPWDWLLTHHLLM 132

  Fly   144 -----------NEDGSSANDAG 154
                       :.|||: .|||
plant   133 QLEGDNKGSGKSGDGSN-RDAG 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 41/62 (66%)
NF-YB1NP_001189705.1 CBFD_NFYB_HMF 24..89 CDD:395650 42/64 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2683
eggNOG 1 0.900 - - E2759_KOG0869
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38149
Inparanoid 1 1.050 134 1.000 Inparanoid score I1840
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1529111at2759
OrthoFinder 1 1.000 - - FOG0001364
OrthoInspector 1 1.000 - - otm2648
orthoMCL 1 0.900 - - OOG6_101084
Panther 1 1.100 - - O PTHR11064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X859
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.