DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and NF-YB7

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_178981.1 Gene:NF-YB7 / 815843 AraportID:AT2G13570 Length:215 Species:Arabidopsis thaliana


Alignment Length:120 Identity:61/120 - (50%)
Similarity:82/120 - (68%) Gaps:9/120 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EEDEAS--------GDDSDK-QDGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQEC 73
            |||..|        |..|.| .:.....:||||||||.|:.:|||..:|.||||:|||:|.:|||
plant     7 EEDHGSPGVAETNPGSPSSKTNNNNNNNKEQDRFLPIANVGRIMKKVLPGNGKISKDAKETVQEC 71

  Fly    74 VSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRES 128
            |||||||::.||.::...|.|||:||||::.|.:.|||::||.||.:||.|||::
plant    72 VSEFISFVTGEASDKCQREKRKTINGDDIIWAITTLGFEDYVAPLKVYLCKYRDT 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 37/62 (60%)
NF-YB7NP_178981.1 CBFD_NFYB_HMF 40..104 CDD:366318 37/63 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2683
eggNOG 1 0.900 - - E2759_KOG0869
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I1840
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1529111at2759
OrthoFinder 1 1.000 - - FOG0001364
OrthoInspector 1 1.000 - - otm2648
orthoMCL 1 0.900 - - OOG6_101084
Panther 1 1.100 - - O PTHR11064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X859
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.