DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and Fam47c

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001158211.1 Gene:Fam47c / 70864 MGIID:1918114 Length:430 Species:Mus musculus


Alignment Length:116 Identity:22/116 - (18%)
Similarity:46/116 - (39%) Gaps:33/116 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNSEDSQQYLNDMLVKEEDEASGDDSDKQDGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKD 65
            :.:.||.::|::.:.:....|.|   |:|::     .|..|| |......:::...|:....||.
Mouse   170 VDHCEDRRKYIHSVHLPSVAEES---SEKEE-----PEPHRF-PGSRKYSMLQEKKPRKKNPAKQ 225

  Fly    66 A--RECIQECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFDNY 114
            :  ...|.:.|.:|.::::|                      |.:||.|.:
Mouse   226 SLYYHHIPKGVYDFCAWVNS----------------------FGDLGIDEH 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 9/64 (14%)
Fam47cNP_001158211.1 FAM47 1..>178 CDD:291315 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.