DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and nfyba

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001017565.1 Gene:nfyba / 550227 ZFINID:ZDB-GENE-050417-13 Length:204 Species:Danio rerio


Alignment Length:127 Identity:74/127 - (58%)
Similarity:93/127 - (73%) Gaps:8/127 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MLVKEEDEASGDDS--DKQDGG---IMLREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQEC 73
            :|.:|:|   ||:|  |..||.   ...||||.:|||.|:.:|||..|||.|||||||:||:|||
Zfish    26 VLAQEDD---GDESFNDHDDGNGSKDFFREQDIYLPIANVARIMKNAVPQTGKIAKDAKECVQEC 87

  Fly    74 VSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRNL 135
            ||||||||:|||.||...|.|||:||:|:|.|.|.||||.|||||.:||||:||:.|.::.:
Zfish    88 VSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVEPLKLYLQKFREAMKGEKGI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 43/62 (69%)
nfybaNP_001017565.1 CBFD_NFYB_HMF 57..120 CDD:279185 43/62 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582155
Domainoid 1 1.000 94 1.000 Domainoid score I7433
eggNOG 1 0.900 - - E2759_KOG0869
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38149
Inparanoid 1 1.050 144 1.000 Inparanoid score I4428
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1529111at2759
OrthoFinder 1 1.000 - - FOG0001364
OrthoInspector 1 1.000 - - otm24782
orthoMCL 1 0.900 - - OOG6_101084
Panther 1 1.100 - - LDO PTHR11064
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R548
SonicParanoid 1 1.000 - - X859
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.