DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and Fam47e

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001361643.1 Gene:Fam47e / 384198 MGIID:2686227 Length:402 Species:Mus musculus


Alignment Length:136 Identity:27/136 - (19%)
Similarity:52/136 - (38%) Gaps:15/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QQYLND---MLVKEEDEASGDDSDKQDGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDAR-- 67
            |.:||.   :.|||       |:.::|.......:|.|||:.:.......|..:...:.|.|.  
Mouse    45 QGFLNSRHWVFVKE-------DNFRKDCPPHQSPKDAFLPLIHRGAPSATPEKRQSTLLKGATLL 102

  Fly    68 ECIQECVSEFISFISSEAIERSVA---ENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRESN 129
            ..:.:....|:..:.:||.:..:.   :..:.:..:.||.....|..:..:|.:..|.|..|:..
Mouse   103 SKLSKAGKAFLEDVEAEAAQHPLTLYPQLTEALPAELLLQVLEVLDPERKLEDVWAYCQDTRKPM 167

  Fly   130 KSDRNL 135
            |....|
Mouse   168 KEPTEL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 11/67 (16%)
Fam47eNP_001361643.1 FAM47 26..>185 CDD:373183 27/136 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.