DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and NC2beta

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_609736.1 Gene:NC2beta / 34875 FlyBaseID:FBgn0028926 Length:183 Species:Drosophila melanogaster


Alignment Length:91 Identity:37/91 - (40%)
Similarity:50/91 - (54%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EQDRF-LPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGDD 101
            |.|.. ||..:|.||:|..|| ..::|.::||.|..|.||||..|||||.|.....|:||:|.:.
  Fly    14 EDDELTLPRASINKIIKELVP-TVRVANESRELILNCCSEFIHLISSEANEVCNMRNKKTINAEH 77

  Fly   102 LLVAFSNLGFDNYVEPLSIYLQKYRE 127
            :|.|...|||.:|.:.....|...:|
  Fly    78 VLEALERLGFHDYKQEAEAVLHDCKE 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 28/63 (44%)
NC2betaNP_609736.1 H4 15..135 CDD:304892 36/90 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450777
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.