DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and php3

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_593639.1 Gene:php3 / 2542027 PomBaseID:SPAC23C11.08 Length:116 Species:Schizosaccharomyces pombe


Alignment Length:85 Identity:47/85 - (55%)
Similarity:66/85 - (77%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFS 107
            |||.|:.:|||..:|:|.||:|:|::|:|:||||||||::.||.|:...|.|||:.|:|:|:|.:
pombe    12 LPIANVARIMKSALPENAKISKEAKDCVQDCVSEFISFVTGEASEQCTQEKRKTITGEDVLLALN 76

  Fly   108 NLGFDNYVEPLSIYLQKYRE 127
            .|||:||.|.|.|.|.||||
pombe    77 TLGFENYAEVLKISLTKYRE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 33/61 (54%)
php3NP_593639.1 CBFD_NFYB_HMF 12..75 CDD:279185 33/62 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2299
eggNOG 1 0.900 - - E2759_KOG0869
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I1602
OMA 1 1.010 - - QHG56852
OrthoFinder 1 1.000 - - FOG0001364
OrthoInspector 1 1.000 - - oto102175
orthoMCL 1 0.900 - - OOG6_101084
Panther 1 1.100 - - LDO PTHR11064
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R548
SonicParanoid 1 1.000 - - X859
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.