DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and dpb4

DIOPT Version :10

Sequence 1:NP_609997.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_595521.1 Gene:dpb4 / 2540966 PomBaseID:SPBC3D6.09 Length:210 Species:Schizosaccharomyces pombe


Alignment Length:108 Identity:26/108 - (24%)
Similarity:53/108 - (49%) Gaps:4/108 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DSDKQDGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSV 90
            |..|:...:    .|..||...|::::|..:|:...:.|:|.:.:....:.|:||::|.:.|.:.
pombe     4 DKSKETSEL----DDLALPRSIIMRLVKGVLPEKSLVQKEALKAMINSATLFVSFLTSASGEIAT 64

  Fly    91 AENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDR 133
            ..|||.:...|:|.|...:.:..:.:.|..:|:.|..:.|..|
pombe    65 NNNRKILMPQDVLNALDEIEYPEFSKTLKKHLEAYELALKEKR 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_609997.1 HFD_NFYB 36..126 CDD:467032 21/89 (24%)
dpb4NP_595521.1 HFD_POLE3_DPB4 13..99 CDD:467053 21/85 (25%)

Return to query results.
Submit another query.