DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and ncb2

DIOPT Version :10

Sequence 1:NP_609997.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_596283.1 Gene:ncb2 / 2540406 PomBaseID:SPBC30D10.02 Length:161 Species:Schizosaccharomyces pombe


Alignment Length:95 Identity:32/95 - (33%)
Similarity:48/95 - (50%) Gaps:6/95 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFS 107
            ||...:.|::...:|.:....|:||:.:.||..|||..:||||.|....|.:||:..:.::.|..
pombe    12 LPKATVQKMVSDILPVDLTFTKEARDLLIECCVEFIHLVSSEANEICEKEAKKTIAAEHIIKALE 76

  Fly   108 NLGFDNYV-EPLSIYL-----QKYRESNKS 131
            ||.|..|: |.|.:..     ||.||...|
pombe    77 NLEFKEYIAEALEVAAEHKEQQKNREKKSS 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_609997.1 HFD_NFYB 36..126 CDD:467032 29/88 (33%)
ncb2NP_596283.1 COG5150 1..156 CDD:227479 32/95 (34%)

Return to query results.
Submit another query.