DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and DR1

DIOPT Version :10

Sequence 1:NP_609997.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001929.1 Gene:DR1 / 1810 HGNCID:3017 Length:176 Species:Homo sapiens


Alignment Length:121 Identity:38/121 - (31%)
Similarity:61/121 - (50%) Gaps:20/121 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ASGDDSDKQDGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAI 86
            :||:|.|..            :|...|.|::|..:| |.::|.||||.:..|.:|||..|||||.
Human     4 SSGNDDDLT------------IPRAAINKMIKETLP-NVRVANDARELVVNCCTEFIHLISSEAN 55

  Fly    87 ERSVAENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQ-------KYRESNKSDRNL 135
            |......:||::.:.::.|..:|||.:|:..:...||       |.|:::....||
Human    56 EICNKSEKKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENL 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_609997.1 HFD_NFYB 36..126 CDD:467032 31/96 (32%)
DR1NP_001929.1 HFD_Dr1 8..130 CDD:467030 36/117 (31%)
Nuclear localization signal. /evidence=ECO:0000255 100..103 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..176
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.