DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and Nfyb

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_035044.1 Gene:Nfyb / 18045 MGIID:97317 Length:207 Species:Mus musculus


Alignment Length:131 Identity:70/131 - (53%)
Similarity:92/131 - (70%) Gaps:12/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDSQQYLNDMLVKEEDEASGDDSDKQDGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDAREC 69
            :|::..:||    .||.....:|        .||||.:|||.|:.:|||..:||.|||||||:||
Mouse    33 DDTEDSMND----HEDTNGSKES--------FREQDIYLPIANVARIMKNAIPQTGKIAKDAKEC 85

  Fly    70 IQECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRN 134
            :|||||||||||:|||.||...|.|||:||:|:|.|.|.||||:|||||.:||||:||:.|.::.
Mouse    86 VQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKG 150

  Fly   135 L 135
            :
Mouse   151 I 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 42/62 (68%)
NfybNP_035044.1 A domain 1..52 6/30 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..52 6/30 (20%)
B domain 53..142 61/88 (69%)
CBFD_NFYB_HMF 57..122 CDD:395650 42/64 (66%)
Subunit association domain (SAD). /evidence=ECO:0000250 86..97 9/10 (90%)
C domain 143..207 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838312
Domainoid 1 1.000 94 1.000 Domainoid score I7519
eggNOG 1 0.900 - - E2759_KOG0869
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38149
Inparanoid 1 1.050 142 1.000 Inparanoid score I4464
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001364
OrthoInspector 1 1.000 - - oto95431
orthoMCL 1 0.900 - - OOG6_101084
Panther 1 1.100 - - LDO PTHR11064
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R548
SonicParanoid 1 1.000 - - X859
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.780

Return to query results.
Submit another query.