DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and pole-3

DIOPT Version :10

Sequence 1:NP_609997.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_498421.1 Gene:pole-3 / 175921 WormBaseID:WBGene00020823 Length:137 Species:Caenorhabditis elegans


Alignment Length:87 Identity:22/87 - (25%)
Similarity:41/87 - (47%) Gaps:7/87 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SGDDSDKQDGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIE 87
            |.:|.|:.|.    |.....:|...:.::||   ..|...:||||:.|....:.|:..:|..:.:
 Worm     2 SSNDVDQNDD----RIAQMMMPAAIVTRLMK---EDNISASKDARDVIARAAAVFLINLSDVSAQ 59

  Fly    88 RSVAENRKTVNGDDLLVAFSNL 109
            .:..:..||::|||::.....|
 Worm    60 SARDQKHKTISGDDVVKGLREL 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_609997.1 HFD_NFYB 36..126 CDD:467032 18/74 (24%)
pole-3NP_498421.1 HFD_POLE3_DPB4 18..97 CDD:467053 17/67 (25%)

Return to query results.
Submit another query.