DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and nfyb-1

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_493740.1 Gene:nfyb-1 / 173435 WormBaseID:WBGene00021132 Length:403 Species:Caenorhabditis elegans


Alignment Length:143 Identity:63/143 - (44%)
Similarity:84/143 - (58%) Gaps:28/143 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NDMLVKEEDEASGDDSDKQDGGI------------------------MLREQDRFLPICNIIKIM 52
            :|..:.||:|.:.||.:    ||                        :|.:|:|||||.|:::||
 Worm    15 HDHGMPEEEEITEDDMN----GIHNIEEDTRTISEIAMELHHPNKSQVLLDQERFLPIANVVRIM 75

  Fly    53 KVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFDNYVEP 117
            |..:....|:||||:||.|||||||||||:|||.|......|||:..||||.|....|||||.||
 Worm    76 KTQMDPQAKLAKDAKECAQECVSEFISFIASEAAEICNITKRKTITADDLLTAMEATGFDNYAEP 140

  Fly   118 LSIYLQKYRESNK 130
            :.|:|||||:::|
 Worm   141 MRIFLQKYRQAHK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 37/62 (60%)
nfyb-1NP_493740.1 CBFD_NFYB_HMF 64..129 CDD:395650 38/64 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I5602
eggNOG 1 0.900 - - E2759_KOG0869
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1529111at2759
OrthoFinder 1 1.000 - - FOG0001364
OrthoInspector 1 1.000 - - oto20342
orthoMCL 1 0.900 - - OOG6_101084
Panther 1 1.100 - - LDO PTHR11064
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R548
SonicParanoid 1 1.000 - - X859
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.810

Return to query results.
Submit another query.