DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and LOC100362333

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:XP_002729875.1 Gene:LOC100362333 / 100362333 RGDID:2318353 Length:145 Species:Rattus norvegicus


Alignment Length:110 Identity:35/110 - (31%)
Similarity:54/110 - (49%) Gaps:4/110 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 REQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGDD 101
            |.:|..||...|.:|:|..:|....|:|:||..|....|.|:.:.:|.|...::...|||:|..|
  Rat     4 RPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASD 68

  Fly   102 LLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRNLFLDASYPHNED 146
            :|.|...:.|..:|.||...|:.||...|..:    :||....:|
  Rat    69 VLSAMEEMEFQRFVTPLKEALEAYRREQKGKK----EASEQKKKD 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 21/62 (34%)
LOC100362333XP_002729875.1 H4 1..>105 CDD:304892 34/104 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.