DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YB and nfyb

DIOPT Version :9

Sequence 1:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster
Sequence 2:XP_002938118.2 Gene:nfyb / 100135753 XenbaseID:XB-GENE-1006106 Length:268 Species:Xenopus tropicalis


Alignment Length:130 Identity:70/130 - (53%)
Similarity:91/130 - (70%) Gaps:12/130 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DSQQYLNDMLVKEEDEASGDDSDKQDGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDARECI 70
            |::..|||     .|:.:|....       .||||.:|||.|:.:|||..:||.|||||||:||:
 Frog    95 DTEDSLND-----PDDTNGSKES-------FREQDIYLPIANVARIMKNAIPQTGKIAKDAKECV 147

  Fly    71 QECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRNL 135
            |||||||||||:|||.||...|.|||:||:|:|.|.|.||||:|||||.:||||:||:.|.::.:
 Frog   148 QECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 212

  Fly   136  135
             Frog   213  212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 42/62 (68%)
nfybXP_002938118.2 CBFD_NFYB_HMF 120..183 CDD:279185 42/62 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7380
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38149
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1529111at2759
OrthoFinder 1 1.000 - - FOG0001364
OrthoInspector 1 1.000 - - oto105611
Panther 1 1.100 - - LDO PTHR11064
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R548
SonicParanoid 1 1.000 - - X859
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.050

Return to query results.
Submit another query.