DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10462 and STP1

DIOPT Version :9

Sequence 1:NP_609996.2 Gene:CG10462 / 35260 FlyBaseID:FBgn0032815 Length:812 Species:Drosophila melanogaster
Sequence 2:NP_010751.4 Gene:STP1 / 852074 SGDID:S000002871 Length:519 Species:Saccharomyces cerevisiae


Alignment Length:282 Identity:65/282 - (23%)
Similarity:97/282 - (34%) Gaps:105/282 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 CNVLKVVLMPSKILSQDSANAATQRVHVPLNPQTPVPPPELPNTVNLPLLLSK-----TSAPL-- 599
            |:|:.        .|.|.::..|. :.:.|:|:.     .:.:.||...||..     |.||:  
Yeast    80 CSVIP--------CSMDVSDLNTP-ISITLSPEN-----RIKSEVNAKSLLGSRPEQDTGAPIKM 130

  Fly   600 -TGQTSALSNVPVNKGLSPTSINIEKPKVSKKPKKNQSFQCTECLKVFTTFGALRIHKSIHTGEL 663
             ||.||           ||.|.:...|:.|.|...|                          ||.
Yeast   131 STGVTS-----------SPLSPSGSTPEHSTKVLNN--------------------------GEE 158

  Fly   664 PYQCSYCDKRFRTPGQVRVHHRRHTGEKPFKCKI----------C--SLDFTHRETLISHL-SRH 715
            .:.|.|||..||..|.:..|.::|..||.:.|..          |  |..|:.|:|..:|| :||
Yeast   159 EFICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDTYKTHLKARH 223

  Fly   716 I----GMK---RYK----CYGCDKYFVVV-----------------SGLRAHRRLRPDTCGKVKF 752
            :    |:|   |.|    |..|.:||..:                 .|.......|.....|:| 
Yeast   224 VLYPKGVKPQDRNKSSGHCAQCGEYFSTIENFVENHIESGDCKALPQGYTKKNEKRSGKLRKIK- 287

  Fly   753 TARAHGPRV----RVIRGEVVF 770
            |:..|...:    .|:..:|:|
Yeast   288 TSNGHSRFISTSQSVVEPKVLF 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10462NP_609996.2 C2H2 Zn finger 137..157 CDD:275371
C2H2 Zn finger 165..186 CDD:275371
C2H2 Zn finger 639..659 CDD:275368 0/19 (0%)
zf-H2C2_2 651..676 CDD:290200 7/24 (29%)
C2H2 Zn finger 667..687 CDD:275368 8/19 (42%)
zf-H2C2_2 680..704 CDD:290200 8/35 (23%)
C2H2 Zn finger 695..715 CDD:275368 8/32 (25%)
C2H2 Zn finger 723..742 CDD:275368 5/35 (14%)
STP1NP_010751.4 zf-C2H2 160..182 CDD:395048 8/21 (38%)
C2H2 Zn finger 162..182 CDD:275368 8/19 (42%)
C2H2 Zn finger 190..220 CDD:275368 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24396
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.