DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10462 and CG42741

DIOPT Version :9

Sequence 1:NP_609996.2 Gene:CG10462 / 35260 FlyBaseID:FBgn0032815 Length:812 Species:Drosophila melanogaster
Sequence 2:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster


Alignment Length:529 Identity:108/529 - (20%)
Similarity:167/529 - (31%) Gaps:213/529 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 EPLNAEEADRMLLEDNPPLNVKLEPQDEEMPDVSRIKEEQSNGSVWTAIHTPLRNKLRLPALATT 288
            :||:|:||      :.||  |::||.|                           ..||.|..:|:
  Fly    10 DPLSAKEA------EGPP--VQVEPVD---------------------------LSLRSPRASTS 39

  Fly   289 KNQMHLKPGVKRNGLLTSNVESLNKKSNHSVISDDANIPISNQEPSNSS---------------- 337
            ..                     :..|::...|.:..:..||.:|..||                
  Fly    40 HG---------------------SSSSSYKFSSANKAVGYSNGKPGGSSGSSSSSGFGAGSAGSS 83

  Fly   338 ----IAANILKVLPSNCMVIKLPPNTKIFKTPGQAPAAPKDSPTVTLSGTENSTNFIKIPKTISI 398
                .||...:.|.::..|.|||.:.....:|                       |....:.||.
  Fly    84 SLGAFAAQQQQQLYASSGVSKLPFSPFFAASP-----------------------FFFTYRRISG 125

  Fly   399 STVGSMGNPHASAKTVQPTQTHSRSSCFLVDSFNNSK------SRPESMK-------IINEFRNQ 450
            |..|: |....|.|     |..:.:||    |:||..      |...||:       :::.|:|.
  Fly   126 SGSGN-GTGSVSVK-----QEDNNNSC----SYNNGSSSGGAGSAANSMQDYESKFSLLSLFKNP 180

  Fly   451 IRSIEKTLPLPGTVLQSSKVTMDESTSSPMDAPKPVELMLNPSALMVARELEIQYPLYRFMWTCP 515
            .:       ..|...|:|:.|.....||     ||:....:||                  |   
  Fly   181 YK-------FAGGDGQASRKTSPTGGSS-----KPLASNSSPS------------------W--- 212

  Fly   516 LCQRMFEKHCAFRAHLTNKHDLTDEKCNVLKVVLMPSKILSQDSANAATQRVHVPLNPQTPVPPP 580
                                                       .:.|.:...|..|||.......
  Fly   213 -------------------------------------------KSYAGSGSPHAALNPAFGGMGR 234

  Fly   581 ELPNTVNLPLLLSKTSAPLTGQTSALSNVPVNKGLSPTSINIEKPKVSKKPKKNQSFQC-TE-CL 643
            ......|    .|.:.....|..||.       |.:.:|.::.....:...|..:..:| || |.
  Fly   235 GATRKDN----SSFSGINFGGGGSAF-------GFTTSSDSMANGGYNDLSKNRKVHKCDTEGCD 288

  Fly   644 KVFTTFGALRIHKSIHTGELPYQCSY--CDKRFRTPGQVRVHHRRHTGEKPFKCKICSLDFTHRE 706
            ||:|....|:.||..||||.||.|::  |..||....::..|:|:|||.|||:|::|:..|:..:
  Fly   289 KVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSD 353

  Fly   707 TLISHLSRH 715
            .|..|:.||
  Fly   354 HLSLHMRRH 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10462NP_609996.2 C2H2 Zn finger 137..157 CDD:275371
C2H2 Zn finger 165..186 CDD:275371
C2H2 Zn finger 639..659 CDD:275368 10/21 (48%)
zf-H2C2_2 651..676 CDD:290200 13/26 (50%)
C2H2 Zn finger 667..687 CDD:275368 6/21 (29%)
zf-H2C2_2 680..704 CDD:290200 11/23 (48%)
C2H2 Zn finger 695..715 CDD:275368 5/19 (26%)
C2H2 Zn finger 723..742 CDD:275368
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 32/78 (41%)
zf-C2H2 280..304 CDD:278523 10/23 (43%)
C2H2 Zn finger 282..304 CDD:275368 10/21 (48%)
zf-H2C2_2 296..>313 CDD:290200 9/16 (56%)
C2H2 Zn finger 312..334 CDD:275368 6/21 (29%)
zf-H2C2_2 326..351 CDD:290200 11/24 (46%)
C2H2 Zn finger 342..362 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BRQ6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.