DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10462 and klf-2

DIOPT Version :9

Sequence 1:NP_609996.2 Gene:CG10462 / 35260 FlyBaseID:FBgn0032815 Length:812 Species:Drosophila melanogaster
Sequence 2:NP_507995.2 Gene:klf-2 / 186179 WormBaseID:WBGene00009998 Length:299 Species:Caenorhabditis elegans


Alignment Length:255 Identity:62/255 - (24%)
Similarity:102/255 - (40%) Gaps:54/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   508 YRFMWTCPLCQRMFEKHCAFRAHLTN----------------KHDLTDEKCNVLKVVLMPSKILS 556
            |.| .|.|:..::.|:|.....|:..                .||...:..:...:..|...:..
 Worm    53 YHF-HTGPVNNQVIEQHYNHHNHVQQTFEENIPQGPHSSFNFSHDFPQQNNSETHLNHMEPSMTP 116

  Fly   557 QDSANAATQRVHVPLNPQTPVPPPELPNTVNLPLLLSKTSAPLTGQTSALSNVPV-NKGLSPTSI 620
            .:..|:.:...: |...:..||.|.      ..:.....|:.|:|:......:|: ::|      
 Worm   117 MEHQNSGSSTPY-PFEAKLFVPSPA------ASVSSYSFSSDLSGKDEEDPRIPLKDRG------ 168

  Fly   621 NIEKPKVSKKPKKNQS-------------FQC--TECLKVFTTFGALRIHKSIHTGELPYQCSY- 669
            .:..|:.::||||..|             .:|  ..|.||:|....|..|:.:|:||.||.|.: 
 Worm   169 RVYHPQSTEKPKKVPSKRRDKATLDRLRVHKCFYQGCGKVYTKSSHLTAHERVHSGEKPYPCEWP 233

  Fly   670 -CDKRFRTPGQVRVHHRRHTGEKPFKCKICSLDFTHRETLISHLSRH------IGMKRYK 722
             |..||....::..|:|:|||.|||.||.||..|:..:.|..|:.||      .||..:|
 Worm   234 GCSWRFARSDELTRHYRKHTGAKPFACKECSRKFSRSDHLQLHMKRHETDEQDDGMDDFK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10462NP_609996.2 C2H2 Zn finger 137..157 CDD:275371
C2H2 Zn finger 165..186 CDD:275371
C2H2 Zn finger 639..659 CDD:275368 7/21 (33%)
zf-H2C2_2 651..676 CDD:290200 11/26 (42%)
C2H2 Zn finger 667..687 CDD:275368 6/21 (29%)
zf-H2C2_2 680..704 CDD:290200 13/23 (57%)
C2H2 Zn finger 695..715 CDD:275368 7/19 (37%)
C2H2 Zn finger 723..742 CDD:275368 62/255 (24%)
klf-2NP_507995.2 C2H2 Zn finger 205..222 CDD:275368 6/16 (38%)
C2H2 Zn finger 230..252 CDD:275368 6/21 (29%)
zf-H2C2_2 244..269 CDD:290200 13/24 (54%)
C2H2 Zn finger 260..280 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BRQ6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.