| Sequence 1: | NP_609996.2 | Gene: | CG10462 / 35260 | FlyBaseID: | FBgn0032815 | Length: | 812 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_491096.1 | Gene: | ztf-23 / 171880 | WormBaseID: | WBGene00021846 | Length: | 419 | Species: | Caenorhabditis elegans |
| Alignment Length: | 253 | Identity: | 67/253 - (26%) |
|---|---|---|---|
| Similarity: | 93/253 - (36%) | Gaps: | 66/253 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 571 LNPQTPVPPPELPNTVNLPLLLSKTSAPLTGQTSALSNVPVN--KGLSPTSINIEKPKVSKKPKK 633
Fly 634 NQS-----FQCTECLKVFTTFGALRIHKSIHTGELPYQCSYCDKRFRTPGQVRVHHRRHTGEKPF 693
Fly 694 KCK-ICSLDFTHRETLISHLSRHIGMKRYKCYGCDKYFVVVSGLRAHRRLRPDTCGKVKFTARAH 757
Fly 758 GPRVRVIRGEVVFQYHPE--HNGYLRSED-------------PLNILSQRDQTNSTPP 800 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10462 | NP_609996.2 | C2H2 Zn finger | 137..157 | CDD:275371 | |
| C2H2 Zn finger | 165..186 | CDD:275371 | |||
| C2H2 Zn finger | 639..659 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 651..676 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 667..687 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 680..704 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 695..715 | CDD:275368 | 4/20 (20%) | ||
| C2H2 Zn finger | 723..742 | CDD:275368 | 1/18 (6%) | ||
| ztf-23 | NP_491096.1 | C2H2 Zn finger | 251..271 | CDD:275368 | 5/19 (26%) |
| zf-H2C2_2 | 264..288 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 279..299 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 291..317 | CDD:290200 | 11/25 (44%) | ||
| C2H2 Zn finger | 307..328 | CDD:275368 | 4/20 (20%) | ||
| zf-H2C2_2 | 324..344 | CDD:290200 | 8/41 (20%) | ||
| C2H2 Zn finger | 336..357 | CDD:275368 | 11/54 (20%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||