DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lar and PTP1

DIOPT Version :10

Sequence 1:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster
Sequence 2:NP_010051.1 Gene:PTP1 / 851368 SGDID:S000002389 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:298 Identity:93/298 - (31%)
Similarity:140/298 - (46%) Gaps:75/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1787 PCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFI----------DGYRYRSAYIAAQGPV 1841
            |.|..:||.|:|:|||.:||:|..   :.|:||:|||::          .||     |||.|||.
Yeast    50 PRNDARNRYVNIMPYERNRVHLKT---LSGNDYINASYVKVNVPGQSIEPGY-----YIATQGPT 106

  Fly  1842 QDAAEDFWRMLWEHN----STIVVMLTKLKEMGREKCFQYWPH---------------------- 1880
            :...:.||:|.: ||    :.::||:|.|.|..||||:||||.                      
Yeast   107 RKTWDQFWQMCY-HNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDM 170

  Fly  1881 ---ERSVRYQYYVVDPIAEYNMPQYKLREFKV--TDARDGSSRTVRQFQFIDWPEQGVPKSGEGF 1940
               ...::.::..|..:.:|    |.:.:.|:  ||...|..:||..|.|..|.:...|:.....
Yeast   171 TQFPSDLKIEFVNVHKVKDY----YTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPI 231

  Fly  1941 IDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLS-IVLERMQYEGVLD------------- 1991
            ::.....|...   .:..||.|||||||||:|.||.|. ::.:.:.::.:.:             
Yeast   232 MELCAHSHSLN---SRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYT 293

  Fly  1992 ---VFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGS 2026
               :.|.|..|||||..||||:||:.|.|.|| :||.|
Yeast   294 RDLIEQIVLQLRSQRMKMVQTKDQFLFIYHAA-KYLNS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LarNP_001260594.1 I-set 36..129 CDD:400151
Ig strand B 53..57 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 93..97 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 141..228 CDD:472250
Ig strand B 157..161 CDD:409353
Ig strand C 170..174 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 218..221 CDD:409353
IgI_3_RPTP_IIa_LAR_like 237..319 CDD:409401
Ig strand A 237..239 CDD:409401
Ig strand A' 244..248 CDD:409401
Ig strand B 251..259 CDD:409401
Ig strand C 264..270 CDD:409401
Ig strand C' 272..274 CDD:409401
Ig strand D 277..281 CDD:409401
Ig strand E 286..291 CDD:409401
Ig strand F 298..305 CDD:409401
Ig strand G 309..318 CDD:409401
FN3 322..411 CDD:238020
FN3 <382..747 CDD:442628
FN3 712..810 CDD:238020
FN3 832..898 CDD:214495
FN3 <867..1269 CDD:442628
fn3 914..998 CDD:394996
R-PTPc-LAR-1 1498..1735 CDD:350401
R-PTP-LAR-2 1784..2021 CDD:350402 89/291 (31%)
PTP1NP_010051.1 PTP_fungal 79..323 CDD:350509 73/256 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.