DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lar and EPX

DIOPT Version :9

Sequence 1:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster
Sequence 2:NP_000493.1 Gene:EPX / 8288 HGNCID:3423 Length:715 Species:Homo sapiens


Alignment Length:694 Identity:134/694 - (19%)
Similarity:211/694 - (30%) Gaps:268/694 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1188 SAIPSD-YSY-RPPTKITVTTQMAAPQPMVKPDFYGVVNG--EEILVILPQASEEYGPISHYYLV 1248
            ||.|.| .|| :.|...|.|...||       |:..|..|  ||.|  .||.|   ||.:...::
Human    66 SASPMDLLSYFKQPVAATRTVVRAA-------DYMHVALGLLEEKL--QPQRS---GPFNVTDVL 118

  Fly  1249 VVPE-----------DKSNLHKIPDQFLTDDLLPGR-NKPERP--------NAPYIAAKFPQ-RS 1292
            ..|:           .:....:..|::.|   :.|| |...||        .|.::.|::.. .|
Human   119 TEPQLRLLSQASGCALRDQAERCSDKYRT---ITGRCNNKRRPLLGASNQALARWLPAEYEDGLS 180

  Fly  1293 IPFTFHLGSGDDYHNFTNRKLEREKRYRI-FVRAV----VDTPQKHLYTSS--------PFSEFL 1344
            :||           .:|..:  |...:.: .||||    |..|.:.| ||.        .:.:|:
Human   181 LPF-----------GWTPSR--RRNGFLLPLVRAVSNQIVRFPNERL-TSDRGRALMFMQWGQFI 231

  Fly  1345 SLDMREAPPG------------ER---------PHRPDPNWP-------------AEPEVSVNRN 1375
            ..|:..:|..            ||         |.:..||.|             :.|....|:|
Human   232 DHDLDFSPESPARVAFTAGVDCERTCAQLPPCFPIKIPPNDPRIKNQRDCIPFFRSAPSCPQNKN 296

  Fly  1376 KDEPEILWVVLPLMVSTFI---------VSTAL--------IVLCVVKRRRQ------------- 1410
            :...:|      ..:::|:         ||.:|        :.|..:.:|.|             
Human   297 RVRNQI------NALTSFVDASMVYGSEVSLSLRLRNRTNYLGLLAINQRFQDNGRALLPFDNLH 355

  Fly  1411 --PCKTPDQAAVTRPLMAADLGAGPTPSDPVDMRRLNFQTPGMISHPPIPISEFANHIERLKSND 1473
              ||...:::|.....:|.|..:..||      :.....|..|..|     :..|..:.||... 
Human   356 DDPCLLTNRSARIPCFLAGDTRSTETP------KLAAMHTLFMREH-----NRLATELRRLNPR- 408

  Fly  1474 NQKFSQEYESIEPGQQFTWDNSNL--EHNKSKNRYANVTAYDHSRVQLPAVEG------VVGSDY 1530
                              |:...|  |..|.......:..|   |..||.|.|      .:|.  
Human   409 ------------------WNGDKLYNEARKIMGAMVQIITY---RDFLPLVLGKARARRTLGH-- 450

  Fly  1531 INANYCDG------------------------YRKHNAYVA----TQGPLQETFVDFWRMCWELK 1567
             ...||..                        :|..:.|.|    :..||...|...||:.:|  
Human   451 -YRGYCSNVDPRVANVFTLAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYE-- 512

  Fly  1568 TATIVMMTRLEERTRIKCDQYWPTRGTETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIK 1632
             ..|..:.|....|..|.::           |..:.:.|.::.....:|...|.....|.:|.  
Human   513 -GGIDPILRGLMATPAKLNR-----------QDAMLVDELRDRLFRQVRRIGLDLAALNMQRS-- 563

  Fly  1633 QLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEK 1697
                   .|||:|.:.|     .||...|:.|.:       .|.:.|    ::.:..|.|    |
Human   564 -------RDHGLPGYNA-----WRRFCGLSQPRN-------LAQLSR----VLKNQDLAR----K 601

  Fly  1698 IIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVP 1741
            .:::||              |.|.......||.|.::.|....|
Human   602 FLNLYG--------------TPDNIDIWIGAIAEPLLPGARVGP 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LarNP_001260594.1 Ig 35..129 CDD:299845
I-set 36..129 CDD:254352
IG_like 146..227 CDD:214653
Ig 159..228 CDD:299845
I-set 234..318 CDD:254352
Ig3_RPTP_IIa_LAR_like 249..317 CDD:143216
fn3 324..404 CDD:278470
FN3 423..514 CDD:238020
FN3 520..610 CDD:238020
FN3 616..707 CDD:238020
FN3 712..810 CDD:238020
FN3 832..907 CDD:238020
FN3 914..1005 CDD:238020
FN3 1012..1101 CDD:238020
fn3 1106..1198 CDD:278470 6/11 (55%)
PTPc 1476..1731 CDD:214550 52/290 (18%)
PTPc 1503..1731 CDD:238006 48/261 (18%)
PTPc 1763..2022 CDD:214550
PTPc 1791..2022 CDD:238006
EPXNP_000493.1 An_peroxidase 145..683 CDD:281139 110/603 (18%)
myeloperoxidase_like 289..699 CDD:188656 79/442 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.