DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lar and Ptpmeg

DIOPT Version :9

Sequence 1:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster
Sequence 2:NP_001163309.2 Gene:Ptpmeg / 38059 FlyBaseID:FBgn0261985 Length:974 Species:Drosophila melanogaster


Alignment Length:624 Identity:153/624 - (24%)
Similarity:220/624 - (35%) Gaps:225/624 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1207 QMAAPQPMVKPDFYGVVNGEEILVILPQASEEYGPISHYYLVVVPEDKSNLHKIPDQFLTD---- 1267
            :.|:|.||  |..|.  :|:...::||....:  .:.|..    ||..|:|  |..:...|    
  Fly   462 ESASPSPM--PPAYS--SGQHSPILLPTTIAD--AVGHQQ----PESGSDL--ITIRLQADEQGR 514

  Fly  1268 ---------DL-LPGRNKPERPNAPYIAAKFPQRSIPFTFHLGSGDDYHNFTNRKLE--REKRYR 1320
                     || ||.:.....|:.|      ..|..|   .:..||:......|.:.  |.::..
  Fly   515 YGFNVKGGVDLSLPVQVSKVVPHTP------ADRCTP---RVCEGDEVLMINGRDVHGLRHEQVV 570

  Fly  1321 IFVRAVVDTPQKHLYTSSPFSEFLSLDMREAPPGE-----RPHRPDP----------NWPAEPEV 1370
            ..:|                      |.|....||     ||.|..|          ..|...|:
  Fly   571 AMIR----------------------DCRHQASGELLLTVRPQRSAPLLLEEEPLYQYVPESDEI 613

  Fly  1371 SVNRNKDEPEILWVVLPLMVSTFIVSTALIVLCVVKRRRQPCKTPDQAAVTRPLMAADLGAGPTP 1435
            ..:.|..:.:.|:....|::|..:.|.||:....:..|:.|     ..|:|              
  Fly   614 GSHSNLLDGDALFTQSLLLLSDGLASGALLAQYELMYRKNP-----DLAIT-------------- 659

  Fly  1436 SDPVDMRRLNFQTPGMISHPPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHN 1500
                                                          |:.:|.            |
  Fly   660 ----------------------------------------------EARKPA------------N 666

  Fly  1501 KSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCD-----GYRKHNAYVATQGPLQETFVDFW 1560
            ..||||.:::.||.:||.|  |..:.| |||||||.:     |  ..|.|:||||||..|..|||
  Fly   667 APKNRYRDISPYDCTRVSL--VNSLTG-DYINANYVNMEIPGG--AVNRYIATQGPLASTTTDFW 726

  Fly  1561 RMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTE---TYGQIFVTITE-TQELATYSIRTFQLC 1621
            ||..:..:..:||:|.:.|..|.||.||||..|.|   ..|.....::| ..|..::..|.|.| 
  Fly   727 RMVQQESSHLLVMLTTVMESGRQKCHQYWPVTGEELQLAEGFSVRCLSEKPDETGSFVFREFVL- 790

  Fly  1622 RQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRA-------------------------- 1660
             :..:::|.|..:|:.|||||.||..|..||:|..|.||                          
  Fly   791 -KDKHEQRHIHHMQYLAWPDHCVPSDPNLFLEFTERVRAARNRTLLQEIEESLKQVRLMDADADA 854

  Fly  1661 -----------------LTPPE---------------SGPVIVHCSAGVGRTGCYIVIDSMLERM 1693
                             .||.:               :.|||||||||:||||..|::|:.|..|
  Fly   855 DENGGLMRERKCAASNGATPEDETPVSTSVHQCISAANPPVIVHCSAGIGRTGVLILMDTALALM 919

  Fly  1694 KHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEA 1732
            :..:.:.....|..:|.||..|||...||.|:.:.|..|
  Fly   920 EAREPVYPLDIVRTMRDQRACMVQNVSQYRFVCECICAA 958

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LarNP_001260594.1 Ig 35..129 CDD:299845
I-set 36..129 CDD:254352
IG_like 146..227 CDD:214653
Ig 159..228 CDD:299845
I-set 234..318 CDD:254352
Ig3_RPTP_IIa_LAR_like 249..317 CDD:143216
fn3 324..404 CDD:278470
FN3 423..514 CDD:238020
FN3 520..610 CDD:238020
FN3 616..707 CDD:238020
FN3 712..810 CDD:238020
FN3 832..907 CDD:238020
FN3 914..1005 CDD:238020
FN3 1012..1101 CDD:238020
fn3 1106..1198 CDD:278470
PTPc 1476..1731 CDD:214550 102/321 (32%)
PTPc 1503..1731 CDD:238006 99/294 (34%)
PTPc 1763..2022 CDD:214550
PTPc 1791..2022 CDD:238006
PtpmegNP_001163309.2 B41 35..232 CDD:214604
FERM_N 38..102 CDD:286467
FERM_M 125..232 CDD:278785
FERM_C_PTPN4_PTPN3_like 226..320 CDD:270010
FA 333..369 CDD:285894
PDZ_signaling 502..589 CDD:238492 20/119 (17%)
Y_phosphatase 666..955 CDD:278528 99/295 (34%)
PTPc 668..955 CDD:238006 98/293 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443567
Domainoid 1 1.000 133 1.000 Domainoid score I1104
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.