DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lar and PTP-ER

DIOPT Version :9

Sequence 1:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster
Sequence 2:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster


Alignment Length:595 Identity:116/595 - (19%)
Similarity:174/595 - (29%) Gaps:298/595 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly  1420 VTRPLMAAD--------------LGAGPTPSDPVDMRRLN------FQT-PGMISHPPI------ 1457
            :||||....              |.:...|.:..|:.|||      :|| ..:|..||:      
  Fly   783 MTRPLSPQTTSEEFKIYLASIQMLQSASNPLNQFDLIRLNYVFDHSYQTNRNIIEQPPVLGSNAR 847

  Fly  1458 ------------------------PISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLE 1498
                                    .:|..|..|..||.|:.::..::..     ::| || ..|.
  Fly   848 DVETPTDMVPPSSEDSELLASYQTVVSRMAQPIPELKENEQKRIFRDLH-----KEF-WD-LPLN 905

  Fly  1499 H--------NKSKNRYANVTAYDHSRV--------------QLPAVEGVVGSD---YINANYCDG 1538
            |        :::||||..:...::|||              ::.....|..|:   ||||||..|
  Fly   906 HQEKPMVFGSQTKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKG 970

  Fly  1539 --YRKHNAYVATQGPLQETFVDFW-----------RMCWELKTAT----------------IVMM 1574
              | ....||||||||..|..:||           |.|.:..:::                |||:
  Fly   971 PDY-VSKCYVATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVML 1034

  Fly  1575 TRLEERTRIKCDQYWPTRGTETYG-----QIFV--------------------TITETQELATYS 1614
            |...|..|.||..|:|....|.:.     ::|.                    |:..:.:...|.
  Fly  1035 TNFTEANRQKCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYE 1099

  Fly  1615 IR-------------------------TFQLC-------RQGFNDRREI------------KQLQ 1635
            |.                         :|.|.       |.|::.|:.:            ..||
  Fly  1100 ISGRHIGVESVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQ 1164

  Fly  1636 --------FTAWPDHGVPDHPAPFLQF------LRRC---------------------------- 1658
                    :..||||..|......|..      |.:|                            
  Fly  1165 KIYCYHYWYPDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQ 1229

  Fly  1659 ---RALTP-PESGPVIVHCSAGVGRTGCYIVIDSMLERMKH------------------------ 1695
               .|:.| |     ::|||||:|||||:..|.:.:.:::.                        
  Fly  1230 DIFNAVQPLP-----VIHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHN 1289

  Fly  1696 -----------------------------------------EKIIDIYGHVTCLRAQRNYMVQTE 1719
                                                     :..:|:.|.|..||.||..|||..
  Fly  1290 PTDSDSSFTCNTIRHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNS 1354

  Fly  1720 DQYIFIHDAI 1729
            :||..||.||
  Fly  1355 EQYELIHRAI 1364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LarNP_001260594.1 Ig 35..129 CDD:299845
I-set 36..129 CDD:254352
IG_like 146..227 CDD:214653
Ig 159..228 CDD:299845
I-set 234..318 CDD:254352
Ig3_RPTP_IIa_LAR_like 249..317 CDD:143216
fn3 324..404 CDD:278470
FN3 423..514 CDD:238020
FN3 520..610 CDD:238020
FN3 616..707 CDD:238020
FN3 712..810 CDD:238020
FN3 832..907 CDD:238020
FN3 914..1005 CDD:238020
FN3 1012..1101 CDD:238020
fn3 1106..1198 CDD:278470
PTPc 1476..1731 CDD:214550 95/488 (19%)
PTPc 1503..1731 CDD:238006 90/453 (20%)
PTPc 1763..2022 CDD:214550
PTPc 1791..2022 CDD:238006
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 88/453 (19%)
PTPc 917..1364 CDD:238006 88/452 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.