DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lar and PTPN22

DIOPT Version :10

Sequence 1:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster
Sequence 2:NP_057051.4 Gene:PTPN22 / 26191 HGNCID:9652 Length:807 Species:Homo sapiens


Alignment Length:290 Identity:109/290 - (37%)
Similarity:154/290 - (53%) Gaps:24/290 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1749 LQKLLITEPGETISGMEV--EFKKLSNVKMDSSKF--------VTANLPCNKHKNRLVHILPYES 1803
            |||.|.....:.|:..|.  ||.||   |..|:|:        ..|..|.|..|||...||||:.
Human     7 LQKFLDEAQSKKITKEEFANEFLKL---KRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDY 68

  Fly  1804 SRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKE 1868
            |||.|:.|...|.|.|:||:||.|.....||||.|||:.....|||||:||::..|:||.....|
Human    69 SRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYE 133

  Fly  1869 MGREKCFQYW--PHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQ 1931
            ||::||.:||  |.|..:.:..:.|...||.....|.:|..||  ..:..:||:.||.:.:||:.
Human   134 MGKKKCERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKV--KFNSETRTIYQFHYKNWPDH 196

  Fly  1932 GVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVL----DV 1992
            .||.|.:..::.|..|...:|.  ...||.:|||||.||:||...:......:: :|::    .|
Human   197 DVPSSIDPILELIWDVRCYQED--DSVPICIHCSAGCGRTGVICAIDYTWMLLK-DGIIPENFSV 258

  Fly  1993 FQTVRILRSQRPAMVQTEDQYHFCYRAALE 2022
            |..:|.:|:|||::|||::||...|.|.||
Human   259 FSLIREMRTQRPSLVQTQEQYELVYNAVLE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LarNP_001260594.1 I-set 36..129 CDD:400151
Ig strand B 53..57 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 93..97 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 141..228 CDD:472250
Ig strand B 157..161 CDD:409353
Ig strand C 170..174 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 218..221 CDD:409353
IgI_3_RPTP_IIa_LAR_like 237..319 CDD:409401
Ig strand A 237..239 CDD:409401
Ig strand A' 244..248 CDD:409401
Ig strand B 251..259 CDD:409401
Ig strand C 264..270 CDD:409401
Ig strand C' 272..274 CDD:409401
Ig strand D 277..281 CDD:409401
Ig strand E 286..291 CDD:409401
Ig strand F 298..305 CDD:409401
Ig strand G 309..318 CDD:409401
FN3 322..411 CDD:238020
FN3 <382..747 CDD:442628
FN3 712..810 CDD:238020
FN3 832..898 CDD:214495
FN3 <867..1269 CDD:442628
fn3 914..998 CDD:394996
R-PTPc-LAR-1 1498..1735 CDD:350401
R-PTP-LAR-2 1784..2021 CDD:350402 94/242 (39%)
PTPN22NP_057051.4 PTPc-N22 57..290 CDD:350450 93/237 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 676..700
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 724..746
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.