DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lar and Ptgs2

DIOPT Version :9

Sequence 1:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster
Sequence 2:NP_035328.2 Gene:Ptgs2 / 19225 MGIID:97798 Length:604 Species:Mus musculus


Alignment Length:476 Identity:85/476 - (17%)
Similarity:143/476 - (30%) Gaps:202/476 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly  1140 FDAMKVFVDSQGF-----SQTQIVPKREIILK------HYVKTH------TINELSPF------- 1180
            ||..|......||     :..:.:.:.:::||      ||:.||      .:|.: ||       
Mouse    37 FDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNI-PFLRSLIMK 100

  Fly  1181 -------------TTYNVNVSAIPSDYSYR---------------PPTKITVTTQMAAPQPMVKP 1217
                         .||||:       |.|:               ||....      .|.||   
Mouse   101 YVLTSRSYLIDSPPTYNVH-------YGYKSWEAFSNLSYYTRALPPVADD------CPTPM--- 149

  Fly  1218 DFYGVVNGEEILVILPQASEEYGPISHYYLVVVPEDKSNLHKIPDQFLTDDLLPGRNKPERPN-- 1280
               ||...:|:                      |:.|..|.|:   .|..:.:|   .|:..|  
Mouse   150 ---GVKGNKEL----------------------PDSKEVLEKV---LLRREFIP---DPQGSNMM 183

  Fly  1281 ----APYIAAKF----PQRSIPFTFHLGSGDDYHNFTNRKLEREKRYRIF--------------- 1322
                |.:...:|    .:|...||..||.|.|.::.....|:|:.:.|:|               
Mouse   184 FAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVY 248

  Fly  1323 VRAVVDTPQKHLYTSSPFSEFLSLDMREAPPGERPHRPDPNWPAEPEVSVNRNKDEPEILWVVLP 1387
            ...|.||..:.:|.                    ||.|:     ..:.:|.:     |:..:|..
Mouse   249 PPTVKDTQVEMIYP--------------------PHIPE-----NLQFAVGQ-----EVFGLVPG 283

  Fly  1388 LMVSTFIVSTALIVLCVVKRRRQPCKTPDQAAVTRPLMAADLGAGPTPSDPVDMRRLNFQTPGMI 1452
            ||:...|.......:|.:.::..|....:|.                           |||..:|
Mouse   284 LMMYATIWLREHNRVCDILKQEHPEWGDEQL---------------------------FQTSRLI 321

  Fly  1453 ---SHPPIPISEFANHIE----RLKSNDNQKFSQEYE-----SIEPGQQFTW-----DNSNLEHN 1500
               ....|.|.::..|:.    :||.:....|:|:::     :.|....:.|     |..|:|..
Mouse   322 LIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQ 386

  Fly  1501 KSKNR---YANVTAYDHSRVQ 1518
            :...:   |.|....:|...|
Mouse   387 EYSFKQFLYNNSILLEHGLTQ 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LarNP_001260594.1 Ig 35..129 CDD:299845
I-set 36..129 CDD:254352
IG_like 146..227 CDD:214653
Ig 159..228 CDD:299845
I-set 234..318 CDD:254352
Ig3_RPTP_IIa_LAR_like 249..317 CDD:143216
fn3 324..404 CDD:278470
FN3 423..514 CDD:238020
FN3 520..610 CDD:238020
FN3 616..707 CDD:238020
FN3 712..810 CDD:238020
FN3 832..907 CDD:238020
FN3 914..1005 CDD:238020
FN3 1012..1101 CDD:238020
fn3 1106..1198 CDD:278470 20/109 (18%)
PTPc 1476..1731 CDD:214550 11/56 (20%)
PTPc 1503..1731 CDD:238006 4/19 (21%)
PTPc 1763..2022 CDD:214550
PTPc 1791..2022 CDD:238006
Ptgs2NP_035328.2 EGF_CA 19..55 CDD:238011 5/17 (29%)
prostaglandin_endoperoxide_synthase 75..562 CDD:188648 78/438 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.