DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lar and F36H12.10

DIOPT Version :10

Sequence 1:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster
Sequence 2:NP_500756.1 Gene:F36H12.10 / 185396 WormBaseID:WBGene00018124 Length:398 Species:Caenorhabditis elegans


Alignment Length:347 Identity:98/347 - (28%)
Similarity:153/347 - (44%) Gaps:59/347 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1405 VKRRRQPCKTPDQAAVTRPLMAADLGAGPTPSDPVDMRRLNFQTPGMISHPPIPISEFANHIERL 1469
            ||:.::  |...:||...|....::    ||:.|        ||     ||.:     ...:.|.
 Worm    54 VKKEKK--KDDGEAAKGDPTNKTNM----TPAPP--------QT-----HPIV-----EQWVLRA 94

  Fly  1470 KSNDNQKFSQEYESI----EPGQQFTWDNSNLEHN--KSKNRYANVTAYDHSRVQL--PAVEGVV 1526
            ......|..:|:..:    .|.......|:|...:  .:||||.:|...|.|.|:|  |:     
 Worm    95 LDVGVDKLREEFRGLAKYTRPDMTQVMFNANQSPDIAITKNRYQDVPCQDLSAVKLDQPS----- 154

  Fly  1527 GSDYINANY--CDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYW 1589
            ..:||:|||  |. ......::..||||.:|..:||.|..:.|...|||:.:..|..::||.|||
 Worm   155 PCNYIHANYVGCP-MIPEKRFICAQGPLDQTIDEFWWMVIQNKVEQIVMLCKTVEMGKLKCAQYW 218

  Fly  1590 PTRGTETY----GQIFVTITETQEL---ATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDH 1647
            |....|..    |.:...::.::.:   ....|....|...| .....::.||:|.|||.|||..
 Worm   219 PAAQGEKLTLKSGCVVENVSGSKPMERDPEIQITMLNLTYSG-GQTMSVRHLQWTEWPDRGVPPC 282

  Fly  1648 PAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEK----IIDIYGHVTCL 1708
            ....|:.|...|.    ...|::||||||:||||..:.|:.:||::...|    :.::   |..|
 Worm   283 KLTSLELLSAIRG----SKVPIVVHCSAGIGRTGTIVAIEYILEKIAENKPCPPMPEL---VKAL 340

  Fly  1709 RAQRNYMVQTEDQYIFIHDAIL 1730
            |.||.:.:|.:.||:|||..:|
 Worm   341 RDQRAFSIQNDVQYLFIHRVML 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LarNP_001260594.1 I-set 36..129 CDD:400151
Ig strand B 53..57 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 93..97 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 141..228 CDD:472250
Ig strand B 157..161 CDD:409353
Ig strand C 170..174 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 218..221 CDD:409353
IgI_3_RPTP_IIa_LAR_like 237..319 CDD:409401
Ig strand A 237..239 CDD:409401
Ig strand A' 244..248 CDD:409401
Ig strand B 251..259 CDD:409401
Ig strand C 264..270 CDD:409401
Ig strand C' 272..274 CDD:409401
Ig strand D 277..281 CDD:409401
Ig strand E 286..291 CDD:409401
Ig strand F 298..305 CDD:409401
Ig strand G 309..318 CDD:409401
FN3 322..411 CDD:238020
FN3 <382..747 CDD:442628
FN3 712..810 CDD:238020
FN3 832..898 CDD:214495
FN3 <867..1269 CDD:442628
fn3 914..998 CDD:394996
R-PTPc-LAR-1 1498..1735 CDD:350401 79/250 (32%)
R-PTP-LAR-2 1784..2021 CDD:350402
F36H12.10NP_500756.1 PTPc 101..363 CDD:214550 84/276 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.