DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lar and F47B3.7

DIOPT Version :10

Sequence 1:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster
Sequence 2:NP_491276.1 Gene:F47B3.7 / 171983 WormBaseID:WBGene00018531 Length:374 Species:Caenorhabditis elegans


Alignment Length:277 Identity:92/277 - (33%)
Similarity:134/277 - (48%) Gaps:45/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1500 NKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCW 1564
            |..||||.::...:.:||.| ..:| ..||||:|||.....|...::.||||...|..|||.|..
 Worm    90 NPEKNRYTDIKCIEKTRVIL-TTDG-ASSDYIHANYVGISIKPKKFICTQGPKDSTIYDFWAMVI 152

  Fly  1565 ELKTATIVMMTRLEERTRIKCDQYWP-TRG-TETYGQIFVTIT-ETQELATYS-------IRTFQ 1619
            :....:|:|:.::.|..|:||:|||| ..| |.||.....||| ....:.|.|       :...:
 Worm   153 QDNVESIIMLCKVIELARVKCEQYWPAVEGQTNTYVSKGHTITINNLGVGTLSPDDDFINVTNLE 217

  Fly  1620 LCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYI 1684
            |...|  ..|.|...|:|.|||||.|......:..:.....    ::.||:|||||||||:|..:
 Worm   218 LVWAG--KTRSITHYQWTNWPDHGAPPINMGAINLIEAVNY----DTNPVVVHCSAGVGRSGTIV 276

  Fly  1685 VIDSMLERMKHEKIIDIYGHVTC---------LRAQRNYMVQTEDQYIFIHDAILEAIICGVTEV 1740
            .|..::::|       |.| :.|         :|.||:|.:|||.||::||..:||..:      
 Worm   277 GISLIMDKM-------IQG-INCKDMKKLVEEIRNQRHYAIQTEAQYMYIHRVLLEYFL------ 327

  Fly  1741 PARNLHTH-LQKLLITE 1756
               .||.. .:.||:|:
 Worm   328 ---ELHKETYEGLLLTK 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LarNP_001260594.1 I-set 36..129 CDD:400151
Ig strand B 53..57 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 93..97 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 141..228 CDD:472250
Ig strand B 157..161 CDD:409353
Ig strand C 170..174 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 218..221 CDD:409353
IgI_3_RPTP_IIa_LAR_like 237..319 CDD:409401
Ig strand A 237..239 CDD:409401
Ig strand A' 244..248 CDD:409401
Ig strand B 251..259 CDD:409401
Ig strand C 264..270 CDD:409401
Ig strand C' 272..274 CDD:409401
Ig strand D 277..281 CDD:409401
Ig strand E 286..291 CDD:409401
Ig strand F 298..305 CDD:409401
Ig strand G 309..318 CDD:409401
FN3 322..411 CDD:238020
FN3 <382..747 CDD:442628
FN3 712..810 CDD:238020
FN3 832..898 CDD:214495
FN3 <867..1269 CDD:442628
fn3 914..998 CDD:394996
R-PTPc-LAR-1 1498..1735 CDD:350401 87/253 (34%)
R-PTP-LAR-2 1784..2021 CDD:350402
F47B3.7NP_491276.1 PTPc 67..324 CDD:214550 85/249 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.