DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lar and si:ch1073-391i24.1

DIOPT Version :9

Sequence 1:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster
Sequence 2:XP_021322118.1 Gene:si:ch1073-391i24.1 / 101886250 ZFINID:ZDB-GENE-110408-69 Length:315 Species:Danio rerio


Alignment Length:351 Identity:123/351 - (35%)
Similarity:177/351 - (50%) Gaps:62/351 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1689 MLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLL 1753
            ||:..:.|.::|||..|..||::|..|||||:||:|||||||||.:||.|.:||..|.:....:.
Zfish     1 MLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAILEACLCGDTTIPANQLRSVYYDMN 65

  Fly  1754 ITEPGETISGMEVEFKKLSNVK-----MDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHG 1813
            ..:|....|.::.||:.|:.|.     .|.|   .|.||.|..|||.:.:||.:....:|..|.|
Zfish    66 RLDPQTNSSPIKEEFRTLNMVTPTLRVEDCS---IALLPRNHEKNRCMDVLPPDRCLPFLITIDG 127

  Fly  1814 IEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYW 1878
             |.|:|:||:.:|.|:..||:|..|.|:.:..:||||::.:::.|.:|||..             
Zfish   128 -ESSNYINAALMDSYKQPSAFIVTQHPLPNTVKDFWRLVLDYHCTSIVMLND------------- 178

  Fly  1879 PHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWP-EQGVPKSGEGFID 1942
                        |||  ....||            || .|.|:||||:.|| .:..|.|...|:.
Zfish   179 ------------VDP--AQMQPQ------------DG-YRMVQQFQFLGWPMYRDTPVSKRSFLK 216

  Fly  1943 FIGQVHKTKEQF-GQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAM 2006
            .|.||.|.:|:: |.:|...|||..|.||||.|..:|||.|.::::..:|||..|:.||:.:|.|
Zfish   217 LIHQVDKWQEEYDGGEGRTVVHCLNGGGRSGTFCAISIVSEMLRHQRSVDVFHAVKTLRNNKPNM 281

  Fly  2007 V-----------QTEDQYHFCYRAAL 2021
            |           .|...:.||....|
Zfish   282 VDLLVHTALANTHTHVTHSFCAEVQL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LarNP_001260594.1 Ig 35..129 CDD:299845
I-set 36..129 CDD:254352
IG_like 146..227 CDD:214653
Ig 159..228 CDD:299845
I-set 234..318 CDD:254352
Ig3_RPTP_IIa_LAR_like 249..317 CDD:143216
fn3 324..404 CDD:278470
FN3 423..514 CDD:238020
FN3 520..610 CDD:238020
FN3 616..707 CDD:238020
FN3 712..810 CDD:238020
FN3 832..907 CDD:238020
FN3 914..1005 CDD:238020
FN3 1012..1101 CDD:238020
fn3 1106..1198 CDD:278470
PTPc 1476..1731 CDD:214550 23/41 (56%)
PTPc 1503..1731 CDD:238006 23/41 (56%)
PTPc 1763..2022 CDD:214550 89/277 (32%)
PTPc 1791..2022 CDD:238006 79/244 (32%)
si:ch1073-391i24.1XP_021322118.1 Y_phosphatase <1..43 CDD:332578 23/41 (56%)
PTPc 76..292 CDD:214550 85/259 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.