DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10366 and CG14655

DIOPT Version :9

Sequence 1:NP_609995.1 Gene:CG10366 / 35258 FlyBaseID:FBgn0032814 Length:578 Species:Drosophila melanogaster
Sequence 2:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster


Alignment Length:422 Identity:96/422 - (22%)
Similarity:156/422 - (36%) Gaps:129/422 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 QEDNSSAGSLDGSSPSTEKAGEDAADSEKRHQ---------------------CNECLRSYATSK 253
            ||.|.|..:   ..|::.:....||..::|.:                     |:.|..|:..::
  Fly    64 QEGNESPAN---GQPASSRGFLAAAPPKRRAKRTRSKPVVPTPPPVRTTPPAHCDICEFSFRNTE 125

  Fly   254 TLQRHLRQDH------------GQTEPTTEQLQCPDCPKKFRLHYQLERHMK-WHV--------- 296
            ....|:|..|            .|.||..|..:|..|.|.||:...|..|:| .|:         
  Fly   126 LRDMHVRLVHENAEGEPKQKEPQQKEPDQEPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPN 190

  Fly   297 ------PLPKRKQYA------CSSCDK---------------------KFATSASAQQHEQYMHL 328
                  |.|.....|      .|.||:                     .:|.|.:....:|....
  Fly   191 PNPNPSPTPASTTSAVTATPKLSICDRIRHTEPGALGNGNNSTCTASQPYALSGALSMLQQSPSS 255

  Fly   329 DE----RPRPVICEQCGVGVHSMSALKEHVLKHTDYAPFECEVCKKCF---KSANR-LKHHKETH 385
            .|    .|:...|:.|.....:...||:|...||...|:.||:|.:.|   :|.:: |.:|.|. 
  Fly   256 PESGTATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEV- 319

  Fly   386 DPHKYICPECGMQLNSRTTLNRHRLVHTDQMQHKCDYCGREFKRAKALKNHLILHTGLKPYSCDF 450
            .||  :|..||......:||:.|:.:|:.:...||:.||:.|::..:...|..:|||:.||.|:.
  Fly   320 KPH--VCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCEL 382

  Fly   451 CDRTFANGSNCRTHK----KKSHPEELAAQEAAGGGRSHNRNIPKLEALKAFTKNKDNLSPVATK 511
            |.:||....:.|||:    :...||:|                     :|||.:..|:.:     
  Fly   383 CQKTFRYKVSQRTHRCPTEEAQTPEQL---------------------IKAFLEGNDSHT----- 421

  Fly   512 QSGCFAFGKKPRPATKDTPASNPAVIQDAQPE 543
                     :|.||:.:..|.|.:.|.|.:.|
  Fly   422 ---------QPSPASAEIAAINSSSIVDPEQE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10366NP_609995.1 zf-AD 28..108 CDD:285071
PTZ00423 131..>230 CDD:240413 5/19 (26%)
COG5048 <222..408 CDD:227381 57/269 (21%)
C2H2 Zn finger 242..263 CDD:275368 5/20 (25%)
C2H2 Zn finger 275..295 CDD:275368 8/20 (40%)
C2H2 Zn finger 306..357 CDD:275368 13/75 (17%)
C2H2 Zn finger 365..385 CDD:275368 8/23 (35%)
C2H2 Zn finger 392..412 CDD:275368 6/19 (32%)
zf-C2H2 418..440 CDD:278523 6/21 (29%)
C2H2 Zn finger 420..440 CDD:275368 5/19 (26%)
zf-H2C2_2 432..457 CDD:290200 10/24 (42%)
C2H2 Zn finger 448..466 CDD:275368 7/21 (33%)
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
zf-H2C2_2 281..304 CDD:290200 9/22 (41%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
zf-H2C2_2 339..361 CDD:290200 7/21 (33%)
C2H2 Zn finger 352..372 CDD:275368 5/19 (26%)
zf-H2C2_2 364..389 CDD:290200 10/24 (42%)
C2H2 Zn finger 380..396 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2696
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.