DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10366 and kmg

DIOPT Version :9

Sequence 1:NP_609995.1 Gene:CG10366 / 35258 FlyBaseID:FBgn0032814 Length:578 Species:Drosophila melanogaster
Sequence 2:NP_609604.1 Gene:kmg / 34706 FlyBaseID:FBgn0032473 Length:747 Species:Drosophila melanogaster


Alignment Length:666 Identity:119/666 - (17%)
Similarity:203/666 - (30%) Gaps:221/666 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CRLC--AKDDVQ---GNLNVFLKNEDSGEAASMELATAIGKYFWVNITRGEELPETI-----CSE 83
            |:||  |....|   .::.:.....|.|.|.....|...||.......|...|.|:|     ..:
  Fly   149 CKLCLYASRHFQKLVRHMKMVHGCSDDGGAVQGSGAQPRGKRNLSREVRKRRLEESIEGQGATGQ 213

  Fly    84 CLSL-VTSLVNFSERITRVQKLYCILQSTPSQERPNLHELRSKFGLLDEETQTEVHYVDKKPKLD 147
            ||.| |..::                     |..|.|.:|:.:....:.:....|...:::.:: 
  Fly   214 CLDLSVLRMI---------------------QNGPPLEQLKVELQQQEMQLLASVQAYNRQQEM- 256

  Fly   148 EQLEFLPE------ESPYELANPLTPEEKQESVDQEQDQPTEEPDEQDADYEPNEDRVLMSLCDV 206
            .||:.:.|      ...||....|.|.::.||:..||...:.:.:|                   
  Fly   257 LQLQQIVESHDNIFSMAYEFQTKLMPPKQAESLKLEQQNSSSDSEE------------------- 302

  Fly   207 YGIQEDNSSAGSLDGSSPSTEKAGEDAADSEKRHQCNECLRSYATSKTLQRHLRQDHGQTEPTTE 271
                         ...|||.:.  .:....:::.||.:|..|.......::|::..      :..
  Fly   303 -------------TAKSPSPDT--RELVSGKEQFQCQKCSYSTPIRARFKKHVKYH------SMP 346

  Fly   272 QLQCPDCPKKFRLHYQLERHMKWHVPLPKRKQYACSSCDKKFATSASAQQHEQYMHLDERPRPV- 335
            .::|..|.......:.|:||.|.|   .....:.||.||.......|...||...|:   |.|| 
  Fly   347 LIKCSSCDFHTPYKWNLDRHTKNH---GANGHFKCSCCDFSTDIKQSLTIHESNHHV---PMPVH 405

  Fly   336 ------------ICEQCGVGVHSMSALK---------EHVLKHTDYAPFECEVCKKCFKSANRLK 379
                        :.:|...|.......|         |.:|..|  :...|..|:|...:|.:|.
  Fly   406 QMGNRSRDEAEDLVDQQSSGSRKPETFKNGGATVASTESLLPRT--SGIVCSHCQKRVGNAMQLI 468

  Fly   380 HHKETHDPHKYICPECGMQLNSRT----TLNRHRLVHTDQMQH---------------------- 418
            :|.:.          |.:.|::.|    ::|....:|.:...:                      
  Fly   469 NHLQV----------CTLALHNTTQLQASINAEVDLHDEDFPNAPTDLSYCGVETAPGYGEVTEV 523

  Fly   419 ---------------KCDYCGREFKRAKALKNHLILHTGLKPYSCDFCDRTFANGSNCR----TH 464
                           ||.:|......|.....|::.|...||:.|..|    |..||.|    .|
  Fly   524 LPEEPEDLAPLKKVFKCPHCSFWAATASRFHVHIVGHLNRKPFECSLC----AYRSNWRWDITKH 584

  Fly   465 ------KKKSHPEELAAQEAAGGGRSHNRNIPKLEALKAFT-------------------KNKDN 504
                  :.:||.:.........|.|::.:....|..:|...                   :..|:
  Fly   585 IRLKALRDRSHNQAQVLMNDETGRRNYAKYNQYLTMMKVSAEQLADSKGMRTGEMIVMPPEKLDD 649

  Fly   505 LSPVATKQ---------SGCFAFGKKPR-PATKDTPASNPAVIQD-AQPEP-------------- 544
            ..|:.|::         |......:||| ..|:|...::..:.|: |:.||              
  Fly   650 HHPMETEEIIEMVDSAHSTSALDLRKPRDDQTEDLAGNSDELPQEGAKTEPNLEPLSFKSLNSSQ 714

  Fly   545 -APDPGGE--NATQAD 557
             .|.|.|.  |.|:.|
  Fly   715 VMPKPKGSPMNLTKTD 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10366NP_609995.1 zf-AD 28..108 CDD:285071 19/89 (21%)
PTZ00423 131..>230 CDD:240413 16/104 (15%)
COG5048 <222..408 CDD:227381 42/211 (20%)
C2H2 Zn finger 242..263 CDD:275368 4/20 (20%)
C2H2 Zn finger 275..295 CDD:275368 6/19 (32%)
C2H2 Zn finger 306..357 CDD:275368 16/72 (22%)
C2H2 Zn finger 365..385 CDD:275368 6/19 (32%)
C2H2 Zn finger 392..412 CDD:275368 4/23 (17%)
zf-C2H2 418..440 CDD:278523 5/58 (9%)
C2H2 Zn finger 420..440 CDD:275368 4/19 (21%)
zf-H2C2_2 432..457 CDD:290200 6/24 (25%)
C2H2 Zn finger 448..466 CDD:275368 7/27 (26%)
kmgNP_609604.1 C2H2 Zn finger 540..560 CDD:275370 4/19 (21%)
C2H2 Zn finger 568..586 CDD:275370 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444645
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.