Sequence 1: | NP_609995.1 | Gene: | CG10366 / 35258 | FlyBaseID: | FBgn0032814 | Length: | 578 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494634.1 | Gene: | sdz-12 / 184388 | WormBaseID: | WBGene00017406 | Length: | 330 | Species: | Caenorhabditis elegans |
Alignment Length: | 335 | Identity: | 73/335 - (21%) |
---|---|---|---|
Similarity: | 115/335 - (34%) | Gaps: | 101/335 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 201 MSLCDVYGIQEDNSSAGSLDGSSPSTEKAGEDAADSEKRHQCNECLRSYATSKTLQRHLRQDH-- 263
Fly 264 ---GQTEPTTEQLQCPDCPKKFRLHYQLERHMKWHVPLPKRKQYACSSCDKKFATSASAQQHEQY 325
Fly 326 MHLDERPR---PVICEQCGVGVHSMSALKEHVLKHTDYAPFECEVCKKCFKSANRLKH------- 380
Fly 381 -HKE----------------------THDPHKYIC------PECGMQLNSRTT--------LNRH 408
Fly 409 RLVHTDQM----------------------QHKCDYCGREFKRAKALKNHLILHTGLKPYSCDFC 451
Fly 452 DRTFANGSNC 461 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10366 | NP_609995.1 | zf-AD | 28..108 | CDD:285071 | |
PTZ00423 | 131..>230 | CDD:240413 | 5/28 (18%) | ||
COG5048 | <222..408 | CDD:227381 | 52/237 (22%) | ||
C2H2 Zn finger | 242..263 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 275..295 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 306..357 | CDD:275368 | 14/53 (26%) | ||
C2H2 Zn finger | 365..385 | CDD:275368 | 8/49 (16%) | ||
C2H2 Zn finger | 392..412 | CDD:275368 | 5/33 (15%) | ||
zf-C2H2 | 418..440 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 420..440 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 432..457 | CDD:290200 | 6/24 (25%) | ||
C2H2 Zn finger | 448..466 | CDD:275368 | 4/14 (29%) | ||
sdz-12 | NP_494634.1 | SFP1 | <25..86 | CDD:227516 | 19/62 (31%) |
C2H2 Zn finger | 29..48 | CDD:275368 | 8/20 (40%) | ||
COG5236 | <32..>197 | CDD:227561 | 42/172 (24%) | ||
C2H2 Zn finger | 65..85 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 93..113 | CDD:275368 | 6/20 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S4961 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |