DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10366 and tra-4

DIOPT Version :9

Sequence 1:NP_609995.1 Gene:CG10366 / 35258 FlyBaseID:FBgn0032814 Length:578 Species:Drosophila melanogaster
Sequence 2:NP_001370327.1 Gene:tra-4 / 180575 WormBaseID:WBGene00018740 Length:543 Species:Caenorhabditis elegans


Alignment Length:464 Identity:87/464 - (18%)
Similarity:141/464 - (30%) Gaps:151/464 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GLLDEETQTEVHYVDKKPKLDEQLEFLPEESPYELANPLTPEEKQESVDQEQDQPTEE------- 184
            |..|::.....:..|..|.|:.:...:.|:..|:              |:|.|...||       
 Worm    60 GTYDDDEMDLNNKTDLIPLLETEKTTINEDELYD--------------DEEDDDDDEEIKKGIGF 110

  Fly   185 -------------PDEQDADYEPNEDRVLMS---------------------------------- 202
                         |.|::   ||.::|..:|                                  
 Worm   111 ELLAQALGMSAKVPVEKE---EPEKERAKLSGVGEFMKQIRGEIKPIQKERIVLDELGFRVRDPS 172

  Fly   203 ---LCDVYGIQEDNSSAGSLDGSSPSTEKAGEDA-----ADSEKRHQCNECLRSYATSKTLQRHL 259
               .|.:..:|:..:.|...||.......|..|.     ...:|..:|.:|...:......:|||
 Worm   173 KFPPCRIAEVQQTLTLADHQDGIDLPPPNAPTDVRIVRKLIRQKMVRCKKCKNRFIEKNIYERHL 237

  Fly   260 RQDH----------------------------------GQTEPTTEQLQCPDCPKKFRL------ 284
            |..|                                  |...|..|..|..:.|....|      
 Worm   238 RDKHPDLYEEYIREQEEEVELQRLEEIEANRIEELQTGGFIPPENEISQPSEDPNYIPLPGENNG 302

  Fly   285 -------HY----QLERHMKWHVPLPKRKQYACSSCDKKFATSAS-----AQQHEQYMHLDERPR 333
                   :|    ||:|      |..|:....|..|||:|....|     |::||:.:...:   
 Worm   303 GLVPRFDYYGRIKQLKR------PYKKKVSPQCPFCDKRFRNEFSLKKHFAKKHEEMVEFQQ--- 358

  Fly   334 PVICEQCGVGVHSMSALKEHVLKHTDYAPFECEVCKKCFKSANRLKHHKETHDPHK--YICPECG 396
               |.:|...|.:.:.:..|..:.| |..|||...:........|.|.|:.|....  :.|..|.
 Worm   359 ---CLKCFKCVENDAEMANHDCELT-YVCFECTPIRNLCTDNRLLNHRKKFHRGANSGFRCSFCN 419

  Fly   397 MQLNSRTTLNRH-RLVHTDQMQHKCDYCGREFKRAKALKNHLILHTGLKPYSCDFCDRTFANGSN 460
            |:..:...|.:| ::.|......:|.:|...|....|:..|..:|||:..:.|..||......:.
 Worm   420 MKFLTPRKLRKHKKMSHVFTKTFQCHFCEEIFISEVAVMTHERMHTGIIKFECKVCDFRANRYTA 484

  Fly   461 CRTHKKKSH 469
            ...||:..|
 Worm   485 MEEHKRDEH 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10366NP_609995.1 zf-AD 28..108 CDD:285071
PTZ00423 131..>230 CDD:240413 21/155 (14%)
COG5048 <222..408 CDD:227381 48/248 (19%)
C2H2 Zn finger 242..263 CDD:275368 6/20 (30%)
C2H2 Zn finger 275..295 CDD:275368 6/36 (17%)
C2H2 Zn finger 306..357 CDD:275368 13/55 (24%)
C2H2 Zn finger 365..385 CDD:275368 4/19 (21%)
C2H2 Zn finger 392..412 CDD:275368 5/20 (25%)
zf-C2H2 418..440 CDD:278523 5/21 (24%)
C2H2 Zn finger 420..440 CDD:275368 5/19 (26%)
zf-H2C2_2 432..457 CDD:290200 8/24 (33%)
C2H2 Zn finger 448..466 CDD:275368 4/17 (24%)
tra-4NP_001370327.1 COG5236 <329..>519 CDD:227561 42/172 (24%)
C2H2 Zn finger 415..436 CDD:275368 5/20 (25%)
C2H2 Zn finger 444..464 CDD:275368 5/19 (26%)
C2H2 Zn finger 472..490 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.