DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10366 and lin-13

DIOPT Version :9

Sequence 1:NP_609995.1 Gene:CG10366 / 35258 FlyBaseID:FBgn0032814 Length:578 Species:Drosophila melanogaster
Sequence 2:NP_498678.3 Gene:lin-13 / 176083 WormBaseID:WBGene00003002 Length:2248 Species:Caenorhabditis elegans


Alignment Length:490 Identity:98/490 - (20%)
Similarity:164/490 - (33%) Gaps:162/490 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 DEQDADYE-------PNEDRVLMSLCDVYG------IQEDNSSAGSLDGSSPSTEKAGEDAADSE 237
            ||.|.|.|       |..:.|:..:.|..|      :.|..:|.|:|    ||:..||.     |
 Worm  1498 DEDDTDLEVAQGGKSPYGEPVVKEVVDENGDDELAVVAEVENSTGTL----PSSISAGR-----E 1553

  Fly   238 KRHQCNECLRSYATSKTLQRHL---RQDHG---------------------------QTEPTTEQ 272
            |:.:|.:|..::.|:.:|:.|:   |||.|                           :.:|..::
 Worm  1554 KKFKCQKCSLAFYTNGSLESHMRDHRQDAGAQLCTETYGIPVVTKASWLCRNCCVVFENQPKYQK 1618

  Fly   273 ---------LQCPDCPKKFRLHYQLERHMKWHVPLPKRKQYACSSCDKKFATSASAQQHEQYMHL 328
                     |.|..|......|..::.|||.|.  .|:.:|:|.:|...||:..:...|....| 
 Worm  1619 HMAIHGDTCLTCIHCSGIAFNHTAIQNHMKSHE--EKKVRYSCGTCLCTFASDLALFDHLSVAH- 1680

  Fly   329 DERPRPVICEQCGVGVHSMSALKEHVLKHTDYAPFECEVCKKCFKSANRLKHHKETHDPHKY--- 390
                        ||.::                 :.|:||.....||:.:..|...|:.|.|   
 Worm  1681 ------------GVSLY-----------------YFCKVCGFGSTSADSVFQHISIHNGHNYSLV 1716

  Fly   391 ----ICP------------ECGMQLNSRTTLNRHRLVHTDQMQHK-----CD--------YCGRE 426
                .||            |...|:.::|.    :||......|:     |:        :|.:.
 Worm  1717 QRFGACPAQLLNYDPTDELEFRSQILNKTI----QLVSPSDCSHRSMLLQCETVVSCKTCHCTQA 1777

  Fly   427 FKRAKALKNHLILHTGL---------KPYSCDFCDRTFANGSNCRTHKKKSHPEELAAQEAAGGG 482
            :....|..|| ...||.         ..|..||......|..|..:..:..:.:..:|..:.|..
 Worm  1778 WFNYMAFNNH-SEETGFPQFKNVDLANDYRRDFPLSRHLNERNALSMSQFGNAKHGSANHSHGQA 1841

  Fly   483 RSHNR----NIPKLEAL--KAFTKNKDNLSPVATKQSGCFAFGKKPRPATKDTPASNPAVIQDAQ 541
            :.:.|    .:|...|.  .:...|..::..|.|..      |:..||:   .|.|....::.|.
 Worm  1842 QPNKRTFRHEVPYRTAAPRSSLQTNGSSMGSVTTNG------GRVVRPS---PPNSMNVTLRRAP 1897

  Fly   542 PEPAPDPGGENATQADTPAAAIPTLDNIY-NHIMI 575
            |:.||       .:....|.:.|...|:. ||:.:
 Worm  1898 PQQAP-------PRRIVIANSAPNNTNVLRNHVAV 1925

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10366NP_609995.1 zf-AD 28..108 CDD:285071
PTZ00423 131..>230 CDD:240413 15/56 (27%)
COG5048 <222..408 CDD:227381 48/243 (20%)
C2H2 Zn finger 242..263 CDD:275368 7/23 (30%)
C2H2 Zn finger 275..295 CDD:275368 6/19 (32%)
C2H2 Zn finger 306..357 CDD:275368 8/50 (16%)
C2H2 Zn finger 365..385 CDD:275368 6/19 (32%)
C2H2 Zn finger 392..412 CDD:275368 6/31 (19%)
zf-C2H2 418..440 CDD:278523 6/34 (18%)
C2H2 Zn finger 420..440 CDD:275368 5/27 (19%)
zf-H2C2_2 432..457 CDD:290200 8/33 (24%)
C2H2 Zn finger 448..466 CDD:275368 4/17 (24%)
lin-13NP_498678.3 C2H2 Zn finger 961..982 CDD:275368
C2H2 Zn finger 986..1003 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.