DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10366 and znf462

DIOPT Version :9

Sequence 1:NP_609995.1 Gene:CG10366 / 35258 FlyBaseID:FBgn0032814 Length:578 Species:Drosophila melanogaster
Sequence 2:XP_002934034.2 Gene:znf462 / 100492944 XenbaseID:XB-GENE-976911 Length:2458 Species:Xenopus tropicalis


Alignment Length:550 Identity:111/550 - (20%)
Similarity:175/550 - (31%) Gaps:191/550 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CSECLSLVTSLV-----------NFSERITRVQKLYCILQSTPSQERPNLHELRSKFG---LLDE 131
            |..|.|.:.|:.           :|.:|..|.::...:|.   .|:...:.|.:.|.|   .|.:
 Frog  1797 CKHCNSKLNSVADLTIHLNAHNEDFQKRAKRQERRKQLLN---KQKLTEIAENKEKMGNEAALHK 1858

  Fly   132 ETQ------------TEVH--------YVDKK------PKLDEQLEFLPEESPYELANPLTPE-E 169
            ..:            .|||        ::.|.      |:|...|    ::..||..:..|.| :
 Frog  1859 SCKEKAVVGYKCKFCVEVHPTLRAICNHLRKHVQYGNVPELSSDL----QDEKYEFTDEDTIEYD 1919

  Fly   170 KQESVDQEQDQPTEE---PDEQDADYEPNE-----------------DRVLMSLCDVYGIQEDNS 214
            ..:.||.|:::..||   |.|::...|..|                 ||||||:   .|::....
 Frog  1920 YDDGVDDEEEEDVEEASTPAEENPVDEAKETKKGRRTRPGGYPCKQCDRVLMSM---QGLRSHER 1981

  Fly   215 SAGSLDGSSPSTEKAGEDAADSEKRHQCNECLRSYATSKTLQRHLRQDHGQTEPTTEQLQCPDCP 279
            |..:|            .....:.::.|..|....|....|.||::..||..:|    .:|..||
 Frog  1982 SHLAL------------AMFTRDDKYSCQFCSFVSAFRHNLDRHVQTHHGHHKP----FRCKLCP 2030

  Fly   280 KKFRLHYQLERH-MKWHVPLPKRKQYACSSCDKKFATSASAQQHEQYMH---------------- 327
            .|...:.:|:.| ||.|.   ....|.||.|.....|.:..:.|...:|                
 Frog  2031 FKSSYNSRLKTHIMKAHA---GEHAYKCSFCPFSTMTISQLKDHSLKVHGKTLTLPRIRTISQTS 2092

  Fly   328 --------------LDE-----------------------------RPRPVI------------- 336
                          ||:                             .|.||.             
 Frog  2093 PRAKQTTRIGKESGLDDSSYSEPPDVQQQLNHYQSAALARYNNNSPAPLPVSSTSAEQNQEAVLN 2157

  Fly   337 CEQCGVGVHSMSALKEHVL-KHTDYAPFECEVCK--KCFKSANRLKHHKETHD------PHKYIC 392
            ||.|......:.:::.|.. ||.....|:|:.|.  .|||||..: |.:..|.      |....|
 Frog  2158 CEFCDFSSGYIQSIRRHYRDKHGGKKLFKCKDCSFYTCFKSAFTM-HVEAGHSATPMEGPKDLRC 2221

  Fly   393 PECGMQLNSRTTLNRHRLVHTDQ------------MQH------KCDYCGREFKRAKALKNHLIL 439
            |.|......:..:..|.::|.::            .:|      :||.|.......:||:.|:..
 Frog  2222 PLCLYHTKYKHNMIDHIVLHREERVVPIEVCRSKLSKHLQGVVFRCDKCTFTCSSDEALQQHIEK 2286

  Fly   440 HTGLKPYSCDFCDRTFANGSNCRTHKKKSH 469
            |..||||.|..|...........||.::.|
 Frog  2287 HNELKPYKCQLCYYETKLSEELDTHLREEH 2316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10366NP_609995.1 zf-AD 28..108 CDD:285071 7/37 (19%)
PTZ00423 131..>230 CDD:240413 29/145 (20%)
COG5048 <222..408 CDD:227381 50/267 (19%)
C2H2 Zn finger 242..263 CDD:275368 6/20 (30%)
C2H2 Zn finger 275..295 CDD:275368 8/20 (40%)
C2H2 Zn finger 306..357 CDD:275368 15/123 (12%)
C2H2 Zn finger 365..385 CDD:275368 8/21 (38%)
C2H2 Zn finger 392..412 CDD:275368 4/19 (21%)
zf-C2H2 418..440 CDD:278523 7/27 (26%)
C2H2 Zn finger 420..440 CDD:275368 6/19 (32%)
zf-H2C2_2 432..457 CDD:290200 10/24 (42%)
C2H2 Zn finger 448..466 CDD:275368 4/17 (24%)
znf462XP_002934034.2 C2H2 Zn finger 1963..1983 CDD:275370 7/22 (32%)
zf-H2C2_5 1995..2019 CDD:372805 6/23 (26%)
C2H2 Zn finger 1997..2017 CDD:275368 6/19 (32%)
C2H2 Zn finger 2026..2047 CDD:275368 8/20 (40%)
zf-H2C2_5 2053..2078 CDD:372805 7/24 (29%)
C2H2 Zn finger 2055..2076 CDD:275368 5/20 (25%)
C2H2 Zn finger 2221..2241 CDD:275368 4/19 (21%)
C2H2 Zn finger 2267..2287 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.