DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PCNA2 and dnaN

DIOPT Version :10

Sequence 1:NP_609994.1 Gene:PCNA2 / 35257 FlyBaseID:FBgn0032813 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_418156.1 Gene:dnaN / 948218 ECOCYCID:EG10242 Length:366 Species:Escherichia coli


Alignment Length:130 Identity:32/130 - (24%)
Similarity:52/130 - (40%) Gaps:23/130 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RTADYELKLLNLDQDHMEIPKKDYTCFIQ--------LPSSEFARICRDMSMFDESLTIACSSKG 166
            :.||..|.|...|.: ||:..:  ...:|        :|:.:|..|||.:   .|...||...:|
E. coli    36 QVADGTLSLTGTDLE-MEMVAR--VALVQPHEPGATTVPARKFFDICRGL---PEGAEIAVQLEG 94

  Fly   167 IRFLAKGDLGTANIQLSAGTAMDV------SIEVQEPVTQSFAGRYLNTFTKATPLADRVKLYLS 225
            .|.|.:.  |.:...||...|.|.      ..||:..:.|:...|.:.. |:.:.....|:.||:
E. coli    95 ERMLVRS--GRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEA-TQFSMAHQDVRYYLN 156

  Fly   226  225
            E. coli   157  156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PCNA2NP_609994.1 beta_clamp 1..254 CDD:478224 32/130 (25%)
dnaNNP_418156.1 PRK05643 1..366 CDD:235541 32/130 (25%)

Return to query results.
Submit another query.