DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PCNA2 and pcna

DIOPT Version :9

Sequence 1:NP_609994.1 Gene:PCNA2 / 35257 FlyBaseID:FBgn0032813 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001007921.1 Gene:pcna / 493302 XenbaseID:XB-GENE-972522 Length:261 Species:Xenopus tropicalis


Alignment Length:259 Identity:127/259 - (49%)
Similarity:191/259 - (73%) Gaps:5/259 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLEARLSQTLLLKKIVDALKEIIAQGTLDCSENGLELQSMDNSHVSLVALSLASDCFEKFHCDRN 65
            |.||||.|..:|||:::|||::|.:...|.:.:|:.|||||:||||||.|:|.||.|:.:.||||
 Frog     1 MFEARLVQGSILKKVLEALKDLIDEACWDITSSGISLQSMDSSHVSLVQLTLRSDGFDTYRCDRN 65

  Fly    66 VSLGLDLKSLGKVLKCANSDDAVTIKAVDRPEKITLSFESDGKERTADYELKLLNLDQDHMEIPK 130
            .|:|:.:.|:.|:||||.|:|.:|::|.|..:.:|:.|||..:|:.:|||:||::||.:.:.||:
 Frog    66 QSIGVKMSSMSKILKCAASEDIITLRAEDNADTVTMVFESPNQEKVSDYEMKLMDLDVEQLGIPE 130

  Fly   131 KDYTCFIQLPSSEFARICRDMSMFDESLTIACSSKGIRFLAKGDLGTANIQLSAGTAMD-----V 190
            ::|:|.|::||.||||||||:|...:::.|:|:..|::|.|.|:|||.|::||..:.:|     |
 Frog   131 QEYSCVIKMPSGEFARICRDLSQIGDAVVISCAKDGVKFSASGELGTGNVKLSQTSNVDKEEEAV 195

  Fly   191 SIEVQEPVTQSFAGRYLNTFTKATPLADRVKLYLSDERPLLVEYPIEDYGHIRYYLAPKVNDPD 254
            :||:.|||..:||.||||.|||||||:..|.|.:|.:.||:|||.|.|.||::||||||:.|.:
 Frog   196 TIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADIPLVVEYKIADMGHVKYYLAPKIEDEE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PCNA2NP_609994.1 pcna 1..254 CDD:273158 127/257 (49%)
pcnaNP_001007921.1 pcna 1..259 CDD:273158 127/257 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012066at2759
OrthoFinder 1 1.000 - - FOG0003572
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2443
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.