DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hakai and AT5G01160

DIOPT Version :9

Sequence 1:NP_001260593.1 Gene:Hakai / 35256 FlyBaseID:FBgn0032812 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001331186.1 Gene:AT5G01160 / 831742 AraportID:AT5G01160 Length:360 Species:Arabidopsis thaliana


Alignment Length:303 Identity:66/303 - (21%)
Similarity:115/303 - (37%) Gaps:80/303 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 IGEKVLNPMIHCCDQCDKPILVYGRMIPCKHVFCLKCARAEPIKSCPRCTDKVLRVEQ-SGLGTV 231
            :||:|     |.|.:||.||.:|||:|||.|.|||:|||::.|  |..|.:::.:::. ..:..:
plant    65 LGERV-----HFCVRCDFPIAIYGRLIPCDHAFCLECARSDSI--CYLCDERIQKIQTIKMMEGI 122

  Fly   232 FMCTHGGSRYGSSGCRRTYLSQRDLQAHINHRHVAPQPPPLQPQPQLSAMAEQPKMTDLGGVGLG 296
            |:|       .:..|.|::|.:.|.:||::..|.:        ..|..|..|....:|:...   
plant   123 FIC-------AAPHCLRSFLKKLDFEAHVHDLHGS--------LLQADAEKEDGNQSDVQST--- 169

  Fly   297 LELHKQRKLSESSVPISVSASIASRPVLSR-LPLTGGVGNIGSIGSIP-------PPGSAAAA-- 351
               .:|...|||::...:.:.:.....|:| ............:.:.|       |||...|:  
plant   170 ---MQQSSASESTLRAPLRSQLQQSRELNRSASFAKSQSGFSQVQNYPPDSDNSRPPGFETASPK 231

  Fly   352 -----------QNAIHGGHSTLTLANLTRINNANAQECHQGKASLHHTLKKGTPHQ--------- 396
                       .|.:......:.:       |.|.....|.....:.|.:.|:..|         
plant   232 PGIRFPDYPQPMNLMQPPSLPVPM-------NQNPGLPQQFGFPSYPTTESGSSQQFFNGAQYEM 289

  Fly   397 SESVADASYYSSVL--------------ASFGSAAGNPGSGPP 425
            :.:.:..|..||:|              .|:...:.|||..||
plant   290 TRTESGGSEQSSLLGYPPPSPMTNLNFQGSYPPPSWNPGMAPP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HakaiNP_001260593.1 RING-HC_HAKAI_like 178..216 CDD:319422 21/37 (57%)
RING-HC finger (C3HC4-type) 180..216 CDD:319422 20/35 (57%)
AT5G01160NP_001331186.1 RING-HC_HAKAI_like 70..106 CDD:319422 21/37 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2932
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005494
OrthoInspector 1 1.000 - - oto3652
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13480
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3911
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.