DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hakai and CBLL2

DIOPT Version :9

Sequence 1:NP_001260593.1 Gene:Hakai / 35256 FlyBaseID:FBgn0032812 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_689790.1 Gene:CBLL2 / 158506 HGNCID:26371 Length:425 Species:Homo sapiens


Alignment Length:350 Identity:105/350 - (30%)
Similarity:140/350 - (40%) Gaps:99/350 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 KWNH-KVSLIGEKVLNPMIHCCDQCDKPILVYGRMIPCKHVFCLKCARAEP---IKSCPRCTDKV 220
            :|.. |:::||||...| ||.||:||.||.:|||:|||||.||..||....   .|.||||...|
Human    37 RWGDIKINIIGEKDDLP-IHFCDKCDLPIKIYGRIIPCKHAFCYHCANLYDKVGYKVCPRCRYPV 100

  Fly   221 LRVEQSGLGTVFMCTHGGSRYGSSGCRRTYLSQRDLQAHINHR------------------HVAP 267
            ||:|....|:||||:.      ...|:||||||:.|||||..|                  |:||
Human   101 LRIEAHKRGSVFMCSI------VQQCKRTYLSQKSLQAHIKRRHKRARKQVTSASLEKVRPHIAP 159

  Fly   268 Q-------PPPLQPQPQLSAM-AEQPKMTDLGGVGLGL-ELHKQRKLSESSVPISVSASIASRPV 323
            .       |..||.:..||.: .||..|..|..|...| |.|.|......:.|..:|.|      
Human   160 PQTEISDIPKRLQDRDHLSYIPPEQHTMVSLPSVQHMLQEQHNQPHKDIQAPPPELSLS------ 218

  Fly   324 LSRLPLTGGVGNIGSIGSIPPPGSAAAAQNAIHGGHSTLTLANLTRINNANAQ---------ECH 379
               ||             .|......:.....||   .||:.::...:::.|:         ||.
Human   219 ---LP-------------FPIQWETVSIFTRKHG---NLTVDHIQNNSDSGAKKPTPPDYYPECQ 264

  Fly   380 QGKA--SLHHTLKK----------GTP--HQ-----SESVADASYYSSVLASFGSAAGNPGSG-- 423
            ...|  |.||.:.:          .:|  ||     .:.|...|..|.|.|.  :...:|.||  
Human   265 SQPAVSSPHHIIPQKQHYAPPPSPSSPVNHQMPYPPQDVVTPNSVRSQVPAL--TTTYDPSSGYI 327

  Fly   424 ----PPGGGATAAAQPANPSGSHSA 444
                ||...:.....|.:.:|:.||
Human   328 IVKVPPDMNSPPLRAPQSQNGNPSA 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HakaiNP_001260593.1 RING-HC_HAKAI_like 178..216 CDD:319422 22/40 (55%)
RING-HC finger (C3HC4-type) 180..216 CDD:319422 21/38 (55%)
CBLL2NP_689790.1 RING 57..100 CDD:238093 23/42 (55%)
HYB domain 96..154 23/63 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 241..297 10/55 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144571
Domainoid 1 1.000 50 1.000 Domainoid score I11690
eggNOG 1 0.900 - - E1_KOG2932
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6974
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005494
OrthoInspector 1 1.000 - - otm42225
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13480
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3911
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.