DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10268 and Pmvk

DIOPT Version :9

Sequence 1:NP_609992.1 Gene:CG10268 / 35255 FlyBaseID:FBgn0032811 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001008353.1 Gene:Pmvk / 310645 RGDID:1310812 Length:194 Species:Rattus norvegicus


Alignment Length:182 Identity:84/182 - (46%)
Similarity:115/182 - (63%) Gaps:9/182 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVLISGKRKCGKDYISERLQRRLGSRSC-IVRISEPIKSEWARKLQLDLDALLGDGPYKEKYRRD 67
            ::|.|||||.|||:::||||.|||...| ::|:|.|:|.::||:..||...||....|||.||||
  Rat    11 VLLFSGKRKSGKDFVTERLQSRLGGNICAVLRLSGPLKEQYAREHGLDFQKLLDASTYKETYRRD 75

  Fly    68 MIVWSDEVRAQDYGYFCRVAMEEALSRQQTPYILVSDVRRKNDIRWFRETYGPERVITLRLTSRP 132
            ||.|.:|.|..|.|:|||..:|..    ..|..||||.||.:||:||:|.|| ....|:|:.:..
  Rat    76 MICWGEEKRQADPGFFCRKIVEGV----SQPIWLVSDTRRMSDIQWFQEAYG-ALTQTVRVVASE 135

  Fly   133 ETRSARGWTFTAGIDDVPSECDLDDLADGFDVVLAN--DEELDQEAIDILLD 182
            ::|..|||.||.|:||..|||.||...| ||.|:.|  ||:..::.::.||:
  Rat   136 QSRQQRGWVFTRGVDDAESECGLDSFGD-FDWVIENHGDEQCLEDQLENLLE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10268NP_609992.1 Pmev_kin_anim 4..188 CDD:130290 84/182 (46%)
PmvkNP_001008353.1 P-mevalo_kinase 14..123 CDD:398111 56/112 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338301
Domainoid 1 1.000 115 1.000 Domainoid score I5892
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4779
Inparanoid 1 1.050 157 1.000 Inparanoid score I4192
OMA 1 1.010 - - QHG52442
OrthoDB 1 1.010 - - D1307762at2759
OrthoFinder 1 1.000 - - FOG0008115
OrthoInspector 1 1.000 - - oto96940
orthoMCL 1 0.900 - - OOG6_107244
Panther 1 1.100 - - LDO PTHR13101
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6067
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.