DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10268 and PMVK

DIOPT Version :9

Sequence 1:NP_609992.1 Gene:CG10268 / 35255 FlyBaseID:FBgn0032811 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_006547.1 Gene:PMVK / 10654 HGNCID:9141 Length:192 Species:Homo sapiens


Alignment Length:188 Identity:82/188 - (43%)
Similarity:117/188 - (62%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVLISGKRKCGKDYISERLQRRLGSRSC-IVRISEPIKSEWARKLQLDLDALLGDGPYKEKYRRD 67
            ::|.|||||.|||:::|.||.|||:..| ::|:|.|:|.::|::..|:...||....|||.:|:|
Human    11 VLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKD 75

  Fly    68 MIVWSDEVRAQDYGYFCRVAMEEALSRQQTPYILVSDVRRKNDIRWFRETYGPERVITLRLTSRP 132
            ||.|.:|.|..|.|:||| .:.|.:|:   |..||||.||.:||:||||.||.. ..|:|:.:..
Human    76 MIRWGEEKRQADPGFFCR-KIVEGISQ---PIWLVSDTRRVSDIQWFREAYGAV-TQTVRVVALE 135

  Fly   133 ETRSARGWTFTAGIDDVPSECDLDDLADGFDVVLAND------EELDQEAIDILLDRL 184
            ::|..|||.||.|:||..|||.||:..| ||.|:.|.      ||..:..|:.:..||
Human   136 QSRQQRGWVFTPGVDDAESECGLDNFGD-FDWVIENHGVEQRLEEQLENLIEFIRSRL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10268NP_609992.1 Pmev_kin_anim 4..188 CDD:130290 82/188 (44%)
PMVKNP_006547.1 P-mevalo_kinase 14..123 CDD:282173 53/112 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144600
Domainoid 1 1.000 106 1.000 Domainoid score I6629
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4779
Inparanoid 1 1.050 146 1.000 Inparanoid score I4433
Isobase 1 0.950 - 0 Normalized mean entropy S3794
OMA 1 1.010 - - QHG52442
OrthoDB 1 1.010 - - D1307762at2759
OrthoFinder 1 1.000 - - FOG0008115
OrthoInspector 1 1.000 - - oto89825
orthoMCL 1 0.900 - - OOG6_107244
Panther 1 1.100 - - LDO PTHR13101
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4070
SonicParanoid 1 1.000 - - X6067
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.850

Return to query results.
Submit another query.