DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10268 and pmvk

DIOPT Version :9

Sequence 1:NP_609992.1 Gene:CG10268 / 35255 FlyBaseID:FBgn0032811 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001077048.1 Gene:pmvk / 100003383 ZFINID:ZDB-GENE-070410-91 Length:199 Species:Danio rerio


Alignment Length:187 Identity:80/187 - (42%)
Similarity:125/187 - (66%) Gaps:9/187 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVLISGKRKCGKDYISERLQRRLGSR-SCIVRISEPIKSEWARKLQLDLDALLGDGPYKEKYRRD 67
            |:|.|||||.||||:::.:|:||.:. .||:|:|.|:|.::|:...||.:.|:|.|.|||.||.|
Zfish     9 ILLFSGKRKSGKDYVTDLIQKRLTAEICCILRLSAPLKEQYAKDHNLDYEELMGSGQYKESYRAD 73

  Fly    68 MIVWSDEVRAQDYGYFCRVAMEEALSRQQTPYILVSDVRRKNDIRWFRETYGPERVITLRLTSRP 132
            ||.|.:..|.:|.|:|||:|::.|..    |..::||.||.:|::||||.: |.:.:.:|:.:..
Zfish    74 MIHWGEMKRQEDSGFFCRLAIKHATQ----PVWIISDCRRMSDVQWFREAF-PNKCVCVRVEASE 133

  Fly   133 ETRSARGWTFTAGIDDVPSECDLDDLADGFDVVLAND--EELDQEAIDILLDRLQLQ 187
            :|||.|||.||:||||..|||.||: ...||.::.||  :::.::.:|.||..::.|
Zfish   134 QTRSERGWRFTSGIDDAESECGLDE-GVKFDRIIRNDGSDDILEKHLDELLSSVRSQ 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10268NP_609992.1 Pmev_kin_anim 4..188 CDD:130290 80/187 (43%)
pmvkNP_001077048.1 P-mevalo_kinase 12..121 CDD:282173 51/113 (45%)
NK <94..185 CDD:302627 37/96 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577735
Domainoid 1 1.000 111 1.000 Domainoid score I6213
eggNOG 1 0.900 - - E1_29ZP3
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4779
Inparanoid 1 1.050 160 1.000 Inparanoid score I4218
OMA 1 1.010 - - QHG52442
OrthoDB 1 1.010 - - D1307762at2759
OrthoFinder 1 1.000 - - FOG0008115
OrthoInspector 1 1.000 - - oto40503
orthoMCL 1 0.900 - - OOG6_107244
Panther 1 1.100 - - LDO PTHR13101
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4070
SonicParanoid 1 1.000 - - X6067
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.