DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spi and nrg1

DIOPT Version :9

Sequence 1:NP_001027281.1 Gene:spi / 35253 FlyBaseID:FBgn0005672 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001264015.1 Gene:nrg1 / 796461 ZFINID:ZDB-GENE-050302-113 Length:730 Species:Danio rerio


Alignment Length:162 Identity:36/162 - (22%)
Similarity:66/162 - (40%) Gaps:28/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TSSTT----MRTTTTTTPRPNITFPTYKCPETFDAWYCLNDAHCFAVKIADLPVYS-CECAIGFM 117
            |::|.    :.|.|:|||....:.....|.|: :..||:|...||.:::....:.. |.|...|.
Zfish   247 TNTTANLFIINTATSTTPSAKTSSHVTPCNES-EKEYCVNHGKCFTLEVTPGNIRRLCRCPNEFT 310

  Fly   118 GQRCE-------YKEIDNTYLPKRPRPMLEKASIASGAMC-ALVFMLFVCLAFYLRFEQRAAKKA 174
            |.||:       ||.:...::  ....:.:|..:....:| ||:.:..:|:..|.:.:::..|..
Zfish   311 GDRCQHYVMASFYKHLGIEFM--EAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLH 373

  Fly   175 YELEQELQQEYDDDDGQCECCRNRCCPDGQEP 206
            ..|.|.|::            ||......|.|
Zfish   374 DRLRQSLRE------------RNAAAKGPQHP 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiNP_001027281.1 None
nrg1NP_001264015.1 I-set 166..255 CDD:254352 2/7 (29%)
Ig 178..253 CDD:299845 2/5 (40%)
PHA03099 257..372 CDD:165381 26/117 (22%)
Neuregulin 333..718 CDD:280343 14/73 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.