DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spi and Krn

DIOPT Version :9

Sequence 1:NP_001027281.1 Gene:spi / 35253 FlyBaseID:FBgn0005672 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster


Alignment Length:183 Identity:87/183 - (47%)
Similarity:108/183 - (59%) Gaps:22/183 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVALVLIGCLAHPWHVEACSSRTVPKPRSSISSSMSGTALPPTQAPVTSSTTMRTTTTTTPRPNI 75
            |:|..|||  |:.....|||||.:.|||             ||.||:.....:.  .:||||||:
  Fly     8 LLATALIG--AYLPLTAACSSRAIAKPR-------------PTAAPILPPDNVE--ISTTPRPNV 55

  Fly    76 TFPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYKEIDNTYLPKRPRPMLE 140
            |||.:.||.|:.|||||||..||.|||.:..:|:||||:||||.||||||||.:|||.|.|.|||
  Fly    56 TFPIFACPPTYVAWYCLNDGTCFTVKIHNEILYNCECALGFMGPRCEYKEIDGSYLPTRNRVMLE 120

  Fly   141 KASIASGAMCALVFMLFVCLAFYLRFEQRAAKKAYELEQELQQEYDDDDGQCE 193
            ||||.|||..||:||...|:..|||.|:...:|.::     .......||.|:
  Fly   121 KASIVSGATLALLFMAMCCVVLYLRHEKLQKQKLHD-----STTTTTTDGGCQ 168



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443725
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2B0SD
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I7314
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D67766at7147
OrthoFinder 1 1.000 - - FOG0009987
OrthoInspector 1 1.000 - - otm49902
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12332
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13533
98.900

Return to query results.
Submit another query.